Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7576
Gene name
LocationContig_9:30202..36074
Strand+
Gene length (bp)5872
Transcript length (bp)5529
Coding sequence length (bp)5529
Protein length (aa) 1843

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20222 DUF6581 Family of unknown function (DUF6581) 1.4E-54 1438 1692
PF20222 DUF6581 Family of unknown function (DUF6581) 3.1E-22 1698 1803
PF04182 B-block_TFIIIC B-block binding subunit of TFIIIC 7.6E-12 142 202

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7576
MALDFEELITHLLMLIACRGENGCTIDEIIGDIIEAVNAHCSSPSAPNLAPDTKQSLPDTACSTVWRWLADRQDV
LVGRGREFNHLSLDELLSLPQASTTTALAASSTSGTNNDEAVRVFTTQDTMWEAMTGHGVDYKRVPKSEWQLLIG
IAGSRGQGILQGDLGRLTCQDKRSVPKRTDVLANKGYIVKRTTLVKGTKTSKMWLKALAPPVPKESDSVPTPRPE
FDLSRQMLVENLDPVPWHHRWTGSDIDFEALATTLMAIVKEWGTLRLRDVKLKLGVLGQRWQMKVLAQTCRFLNA
RGAIQYVAAKLDNAVFKDCISFRRNMTAEDWQLFLSTGKRGRALLVPFGAEEEEEECKQQDRIESQLASRNLASQ
LTPWTVEKPLPQTIIGMVQCSGPKGLSNSILRTLTLGQSFGRYLSSTTSAMTIGSEQPRHLAHLKLRSEHVRNGR
DSRLLFFVGEPDKEDASASACAQEEPPTTTTTTTTTTTTTTAAAVEELYGFLPAAQVGAETAEYHSLSSICIDGV
SVIGIRKHRGRPRRDEPGEGGTVSENPEDPLSVSDEALAQIQMAQTRDNDEQQQCRQQGEEQEKKEEEDQAGHNG
EEVAEEEKEEEQHQQLSPRKLRGKAKQQQATQLSDHSRATRSKVGTSQLNGLPGQDLGSNSDAAANGSLKQARSL
EEQEIEGEFEQKDDDAYEEAGEEAGEEASEDEGAGTSPGLRGSGNRGRGGRRAKRGKRGRGRSRGRLRGGTSRTV
RRPAGAEASDALPWKCSKCGKGWKNDVGLKYHLEKSQTACNQSYTGAPRPEKLSKSAGIDEAPKERPSRTLRRRR
VDVVQDNESDGSGTRARRGGRGAERQVKAEKKVKQQEAVMERLEEMWKRLEPLIGKMEPSTSQAVIVEVPGLVAW
REGAAARLLLHETADQGLVSVLAPRASGTLDKEDDGDSRQLKSKQSTPGARKRMRPSKTTHEVICSLIETLLEQE
KGVMMGGWRLAKAVRAAWHTTSLGDAAPPSDRECREAVKSMIKAKAVTEQWHGFREGGGKGAIFSKCQLLLAPRM
DAFSPAVLALVEKVKGSRPELIEGEAGDDEGGSGSRRRRMWRRRGRRFLGDEVVDLEAPVYAAKLASKRAGEGSG
GNGGGGGGRAKRVKLSAARRGQDLLAQPLGLDDVLIADPERQERAIVFVEANGWLGEAAVGEAAVARDTHLLIDH
QALNDALQAAPSPCPDGFVFDSPNTILGHAGTWPAINEGHFERVDGSWTMRGWMPGPDWFRAASFVDEVEKRSLV
RLRGRSQLGAAPVSRYQRFLCRLRACRDVELAWTCLFAKMGWSPSPRPIQINYSSGPLQLAARPPRQTTWPADEQ
LTPATAKALIDQAYESSASSDDAWPEPAFPKPLSSSSSSSSPPSPLSAPRPTARPRVKRVALVSRALTALPPRSS
SPDAARPRQRPVAADEARELMAAFVAVRALLGGTAKAIDWGLLMTLYPDIELVSLRRFWTDATRRQGAYIANYTR
LLHQRLIGAFEADELPLIDFDAIADYDWRRLIRWTVDLVSSQQGPWVPASREELDRHYALHAAGSARPDWREAFF
GATTSFFARYEAITSEPGAVPLSAQAVDAPVQQQQAVDAVDVAKSWVKALCGTSATRYSAEQLQQQRVVARKGRM
PPGRRPFGLSEWYAALLARLAQTPKYDDAAAFKARLDAAFAAPATPLRRISLVAVDVPHVPLGFEPGNYESRKFP
KSYYHFALDATPTPAYQPTPDIPLVAAVQHEPPPCAGPSGALPQWVDMFGQPHAAWSRVVGAVCFLIAIRGPMSC
SAILAAMHPILHAFELDLVVAWGRRTGLLVDTAADGLAIGLT*
Coding >OphauG2|7576
ATGGCGCTGGATTTTGAGGAGCTGATTACGCATTTGCTGATGCTGATTGCCTGCCGCGGCGAGAATGGATGTACA
ATCGATGAGATTATAGGAGATATCATAGAGGCAGTGAATGCCCATTGTTCCTCACCTTCAGCTCCGAATCTAGCT
CCAGACACCAAGCAATCTCTGCCGGATACAGCATGCTCTACGGTGTGGCGCTGGCTGGCGGATCGACAAGATGTA
TTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCGCTTGATGAGCTTCTCAGCCTGCCCCAAGCCAGCACCACC
ACTGCTCTGGCAGCAAGTAGCACCTCTGGCACCAACAACGATGAAGCCGTCAGGGTCTTTACAACACAAGATACC
ATGTGGGAGGCCATGACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCTCCTTATTGGC
ATTGCAGGCAGCAGGGGGCAGGGGATCCTTCAGGGCGACTTGGGTCGCCTCACCTGCCAGGACAAGCGATCGGTT
CCCAAGCGCACTGATGTGTTGGCCAACAAGGGCTACATCGTCAAGAGGACGACGCTGGTCAAGGGCACCAAGACG
AGCAAGATGTGGCTCAAGGCTTTGGCGCCTCCTGTGCCCAAAGAGAGTGACAGCGTGCCTACACCCAGGCCCGAG
TTCGATCTCTCGCGGCAGATGCTGGTGGAAAATCTGGATCCTGTGCCGTGGCACCATCGCTGGACGGGCAGCGAC
ATTGACTTTGAGGCTCTCGCCACGACGCTCATGGCTATCGTTAAGGAATGGGGCACATTGCGTCTACGAGATGTC
AAGCTGAAGCTGGGTGTCCTGGGCCAGCGCTGGCAGATGAAGGTGCTGGCGCAGACGTGTCGATTTCTCAATGCT
CGCGGTGCCATTCAGTACGTGGCGGCCAAGCTTGACAATGCCGTCTTCAAGGACTGCATTTCCTTTCGGCGCAAC
ATGACGGCCGAGGACTGGCAACTCTTCTTGTCTACGGGGAAACGAGGCCGTGCTCTGCTGGTGCCGTTTGGCGCC
GAGGAAGAAGAAGAGGAGTGCAAGCAACAAGACAGGATTGAGTCTCAGCTGGCGTCAAGAAACCTCGCCAGTCAG
CTGACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTATTGGCATGGTGCAGTGCAGCGGGCCAAAGGGC
CTGTCCAACTCTATTCTCCGGACCCTGACACTGGGACAGTCCTTTGGCCGCTATCTCTCTTCGACTACCTCAGCC
ATGACAATAGGCAGCGAACAGCCTCGGCACCTGGCCCACCTGAAGCTGAGAAGCGAGCATGTGAGAAACGGCAGA
GACTCACGACTCTTGTTCTTTGTGGGAGAGCCAGACAAGGAGGATGCTTCTGCGTCAGCATGTGCCCAAGAGGAA
CCACCAACGACGACGACGACGACAACAACAACAACAACAACAACAACAGCGGCTGCCGTTGAGGAGCTGTATGGA
TTTTTGCCTGCAGCTCAGGTAGGAGCAGAGACTGCAGAGTATCATTCCCTGTCAAGTATTTGCATTGATGGAGTA
TCTGTCATTGGTATAAGAAAACACCGGGGAAGACCGAGGAGAGATGAGCCAGGAGAAGGCGGTACAGTGTCAGAG
AATCCAGAAGATCCTTTATCAGTTTCGGATGAAGCTCTAGCTCAGATTCAAATGGCACAAACAAGAGACAATGAC
GAGCAGCAGCAGTGTCGCCAGCAGGGAGAAGAGCAGGAGAAGAAGGAAGAGGAAGATCAAGCAGGACATAATGGA
GAAGAAGTAGCGGAGGAGGAGAAGGAGGAAGAGCAGCACCAACAGCTGTCGCCTCGAAAGCTCCGCGGAAAGGCC
AAGCAACAGCAGGCAACCCAGTTGTCTGATCACAGCAGAGCAACACGTTCCAAGGTTGGAACAAGTCAACTCAAT
GGATTACCGGGCCAAGACCTTGGCTCAAACTCGGATGCCGCTGCAAATGGGTCTTTAAAACAAGCGAGATCACTC
GAGGAGCAAGAAATAGAGGGAGAATTTGAGCAAAAAGATGATGATGCATATGAGGAGGCAGGCGAGGAGGCAGGG
GAAGAGGCCAGTGAGGATGAGGGGGCAGGAACATCACCGGGATTACGCGGCTCGGGCAATCGAGGCAGAGGAGGG
AGGCGAGCGAAAAGAGGCAAAAGGGGCAGGGGACGGAGTCGCGGGCGGCTGCGTGGCGGCACGAGTAGGACAGTG
CGACGACCAGCAGGGGCCGAAGCGTCAGATGCGCTGCCATGGAAATGCTCAAAGTGCGGCAAGGGATGGAAGAAC
GACGTTGGCCTCAAGTATCATTTGGAAAAGTCGCAGACTGCGTGCAACCAATCATATACGGGCGCGCCGAGGCCC
GAGAAGCTAAGCAAGTCAGCCGGCATTGATGAGGCGCCAAAGGAGCGGCCGTCAAGGACGCTGCGGCGACGGCGT
GTGGATGTGGTCCAGGACAATGAAAGTGATGGCTCTGGGACCAGGGCGAGGCGTGGTGGCCGTGGGGCAGAAAGA
CAAGTCAAGGCAGAGAAGAAGGTGAAGCAGCAGGAAGCAGTCATGGAGCGGCTGGAAGAGATGTGGAAGAGACTG
GAACCACTGATTGGCAAGATGGAGCCGAGTACGAGCCAGGCAGTCATTGTTGAGGTGCCAGGACTGGTGGCGTGG
CGAGAGGGCGCTGCTGCTAGGCTCCTGCTGCACGAGACGGCGGACCAAGGCCTTGTTTCAGTCTTGGCCCCGAGG
GCATCAGGGACGTTGGACAAAGAAGACGACGGGGATTCGAGGCAACTGAAATCCAAACAAAGCACGCCTGGGGCA
CGCAAACGCATGAGACCAAGCAAGACGACACACGAGGTCATCTGTAGCCTCATTGAGACTCTGCTGGAGCAGGAA
AAGGGCGTCATGATGGGCGGATGGCGGCTGGCCAAGGCGGTGAGGGCGGCCTGGCACACGACGAGTCTTGGCGAC
GCTGCGCCGCCCAGTGACAGGGAGTGCCGGGAGGCCGTCAAGAGCATGATCAAGGCCAAGGCGGTGACGGAGCAG
TGGCACGGGTTTCGCGAAGGCGGCGGCAAGGGCGCCATCTTCTCCAAGTGCCAGCTGCTGCTTGCGCCGCGGATG
GACGCCTTTTCGCCCGCGGTGCTAGCGCTGGTGGAAAAGGTCAAGGGGTCGCGGCCCGAGCTGATTGAGGGCGAA
GCAGGCGACGACGAGGGCGGCAGCGGTTCGCGGCGGCGGCGCATGTGGCGGCGGCGAGGGCGGCGGTTCCTGGGC
GACGAGGTGGTTGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCGAGGGCAGTGGC
GGCAATGGTGGTGGTGGTGGTGGCAGGGCAAAGCGCGTCAAGCTCTCGGCGGCGCGCAGAGGACAAGACTTGTTG
GCGCAGCCGCTGGGGCTGGACGACGTGTTGATTGCGGATCCAGAGAGACAAGAGCGGGCCATTGTGTTTGTCGAG
GCGAATGGGTGGCTGGGCGAGGCAGCTGTGGGCGAGGCAGCCGTGGCTAGAGACACACACCTCTTGATCGACCAC
CAAGCCCTCAACGACGCCCTCCAAGCAGCCCCGTCGCCTTGCCCCGACGGCTTCGTCTTTGACAGCCCCAACACC
ATCCTGGGCCACGCAGGCACCTGGCCCGCCATCAACGAAGGCCACTTTGAGCGCGTCGACGGCAGCTGGACCATG
CGCGGCTGGATGCCTGGCCCAGACTGGTTCCGCGCGGCCTCGTTTGTCGACGAGGTCGAGAAGCGCTCCCTGGTG
CGCCTCCGCGGACGCAGCCAACTGGGAGCGGCGCCCGTGTCTCGCTACCAGCGCTTCCTCTGCAGACTGCGCGCC
TGCCGCGACGTCGAGCTGGCCTGGACGTGCCTGTTTGCCAAGATGGGCTGGAGCCCGAGCCCGCGCCCGATCCAA
ATCAACTACTCGTCGGGCCCTCTTCAGCTAGCCGCCCGGCCTCCGCGCCAGACGACCTGGCCGGCCGATGAGCAG
CTGACGCCGGCAACTGCCAAGGCGCTCATCGACCAGGCCTACGAATCGTCGGCTTCATCGGACGACGCGTGGCCC
GAGCCCGCCTTTCCAAAGCCCTTGTCGTCATCGTCGTCGTCGTCGTCGCCGCCGTCGCCGCTGTCGGCTCCGCGC
CCCACTGCCCGGCCAAGGGTCAAGCGCGTTGCCCTCGTCTCTCGCGCGCTGACTGCTCTGCCGCCCAGGTCATCA
TCACCAGACGCTGCTCGACCCCGCCAGCGACCAGTCGCCGCCGACGAGGCGCGCGAGCTCATGGCAGCCTTTGTC
GCGGTGCGGGCGCTGCTGGGCGGCACGGCAAAGGCGATTGACTGGGGCCTGCTCATGACGCTCTACCCCGACATT
GAACTCGTCAGCCTGCGCCGCTTCTGGACCGATGCCACGCGGCGCCAGGGCGCATACATTGCCAACTACACGCGC
CTCCTGCACCAGCGGCTGATTGGCGCCTTTGAGGCGGACGAGCTGCCACTCATTGACTTTGACGCCATTGCCGAC
TATGACTGGCGCCGCCTGATTCGCTGGACCGTCGACCTGGTCAGCAGCCAACAAGGCCCATGGGTGCCGGCGTCG
CGAGAGGAGCTTGATAGGCACTATGCGCTGCACGCGGCCGGCAGCGCGCGGCCGGACTGGCGTGAGGCCTTTTTC
GGCGCCACCACGTCCTTTTTTGCGCGCTACGAGGCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGAGCGCGCAA
GCCGTCGACGCGCCAGTCCAGCAGCAGCAAGCCGTCGATGCCGTCGACGTGGCCAAGTCGTGGGTCAAGGCCCTC
TGCGGCACCAGCGCGACGCGCTACTCGGCCGAGCAGCTCCAGCAGCAGCGCGTCGTTGCGCGCAAGGGCCGCATG
CCGCCGGGCCGCCGCCCCTTTGGCCTGAGCGAGTGGTACGCGGCGCTGCTGGCGCGCCTGGCCCAGACGCCCAAG
TACGACGACGCAGCCGCCTTCAAGGCCCGGCTCGACGCCGCCTTTGCCGCGCCCGCAACGCCCCTGCGCCGCATC
AGCCTCGTCGCCGTCGACGTGCCCCATGTGCCCCTGGGCTTCGAGCCGGGCAACTACGAAAGCCGCAAGTTTCCC
AAGTCGTACTACCACTTTGCCCTCGACGCCACCCCCACGCCCGCATACCAGCCCACGCCCGACATTCCCCTCGTC
GCCGCCGTCCAGCACGAGCCGCCGCCCTGTGCCGGCCCCTCGGGCGCGCTGCCGCAATGGGTCGACATGTTTGGC
CAGCCCCACGCCGCCTGGTCCCGCGTCGTCGGCGCCGTCTGCTTCCTCATCGCCATCCGCGGCCCCATGTCCTGC
TCCGCCATCCTCGCCGCCATGCATCCCATCCTCCACGCCTTTGAGCTGGACCTTGTCGTCGCCTGGGGCCGCCGC
ACCGGCCTCTTGGTTGATACTGCTGCCGACGGCCTAGCCATTGGCCTAACATGA
Transcript >OphauG2|7576
ATGGCGCTGGATTTTGAGGAGCTGATTACGCATTTGCTGATGCTGATTGCCTGCCGCGGCGAGAATGGATGTACA
ATCGATGAGATTATAGGAGATATCATAGAGGCAGTGAATGCCCATTGTTCCTCACCTTCAGCTCCGAATCTAGCT
CCAGACACCAAGCAATCTCTGCCGGATACAGCATGCTCTACGGTGTGGCGCTGGCTGGCGGATCGACAAGATGTA
TTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCGCTTGATGAGCTTCTCAGCCTGCCCCAAGCCAGCACCACC
ACTGCTCTGGCAGCAAGTAGCACCTCTGGCACCAACAACGATGAAGCCGTCAGGGTCTTTACAACACAAGATACC
ATGTGGGAGGCCATGACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCAGCTCCTTATTGGC
ATTGCAGGCAGCAGGGGGCAGGGGATCCTTCAGGGCGACTTGGGTCGCCTCACCTGCCAGGACAAGCGATCGGTT
CCCAAGCGCACTGATGTGTTGGCCAACAAGGGCTACATCGTCAAGAGGACGACGCTGGTCAAGGGCACCAAGACG
AGCAAGATGTGGCTCAAGGCTTTGGCGCCTCCTGTGCCCAAAGAGAGTGACAGCGTGCCTACACCCAGGCCCGAG
TTCGATCTCTCGCGGCAGATGCTGGTGGAAAATCTGGATCCTGTGCCGTGGCACCATCGCTGGACGGGCAGCGAC
ATTGACTTTGAGGCTCTCGCCACGACGCTCATGGCTATCGTTAAGGAATGGGGCACATTGCGTCTACGAGATGTC
AAGCTGAAGCTGGGTGTCCTGGGCCAGCGCTGGCAGATGAAGGTGCTGGCGCAGACGTGTCGATTTCTCAATGCT
CGCGGTGCCATTCAGTACGTGGCGGCCAAGCTTGACAATGCCGTCTTCAAGGACTGCATTTCCTTTCGGCGCAAC
ATGACGGCCGAGGACTGGCAACTCTTCTTGTCTACGGGGAAACGAGGCCGTGCTCTGCTGGTGCCGTTTGGCGCC
GAGGAAGAAGAAGAGGAGTGCAAGCAACAAGACAGGATTGAGTCTCAGCTGGCGTCAAGAAACCTCGCCAGTCAG
CTGACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTATTGGCATGGTGCAGTGCAGCGGGCCAAAGGGC
CTGTCCAACTCTATTCTCCGGACCCTGACACTGGGACAGTCCTTTGGCCGCTATCTCTCTTCGACTACCTCAGCC
ATGACAATAGGCAGCGAACAGCCTCGGCACCTGGCCCACCTGAAGCTGAGAAGCGAGCATGTGAGAAACGGCAGA
GACTCACGACTCTTGTTCTTTGTGGGAGAGCCAGACAAGGAGGATGCTTCTGCGTCAGCATGTGCCCAAGAGGAA
CCACCAACGACGACGACGACGACAACAACAACAACAACAACAACAACAGCGGCTGCCGTTGAGGAGCTGTATGGA
TTTTTGCCTGCAGCTCAGGTAGGAGCAGAGACTGCAGAGTATCATTCCCTGTCAAGTATTTGCATTGATGGAGTA
TCTGTCATTGGTATAAGAAAACACCGGGGAAGACCGAGGAGAGATGAGCCAGGAGAAGGCGGTACAGTGTCAGAG
AATCCAGAAGATCCTTTATCAGTTTCGGATGAAGCTCTAGCTCAGATTCAAATGGCACAAACAAGAGACAATGAC
GAGCAGCAGCAGTGTCGCCAGCAGGGAGAAGAGCAGGAGAAGAAGGAAGAGGAAGATCAAGCAGGACATAATGGA
GAAGAAGTAGCGGAGGAGGAGAAGGAGGAAGAGCAGCACCAACAGCTGTCGCCTCGAAAGCTCCGCGGAAAGGCC
AAGCAACAGCAGGCAACCCAGTTGTCTGATCACAGCAGAGCAACACGTTCCAAGGTTGGAACAAGTCAACTCAAT
GGATTACCGGGCCAAGACCTTGGCTCAAACTCGGATGCCGCTGCAAATGGGTCTTTAAAACAAGCGAGATCACTC
GAGGAGCAAGAAATAGAGGGAGAATTTGAGCAAAAAGATGATGATGCATATGAGGAGGCAGGCGAGGAGGCAGGG
GAAGAGGCCAGTGAGGATGAGGGGGCAGGAACATCACCGGGATTACGCGGCTCGGGCAATCGAGGCAGAGGAGGG
AGGCGAGCGAAAAGAGGCAAAAGGGGCAGGGGACGGAGTCGCGGGCGGCTGCGTGGCGGCACGAGTAGGACAGTG
CGACGACCAGCAGGGGCCGAAGCGTCAGATGCGCTGCCATGGAAATGCTCAAAGTGCGGCAAGGGATGGAAGAAC
GACGTTGGCCTCAAGTATCATTTGGAAAAGTCGCAGACTGCGTGCAACCAATCATATACGGGCGCGCCGAGGCCC
GAGAAGCTAAGCAAGTCAGCCGGCATTGATGAGGCGCCAAAGGAGCGGCCGTCAAGGACGCTGCGGCGACGGCGT
GTGGATGTGGTCCAGGACAATGAAAGTGATGGCTCTGGGACCAGGGCGAGGCGTGGTGGCCGTGGGGCAGAAAGA
CAAGTCAAGGCAGAGAAGAAGGTGAAGCAGCAGGAAGCAGTCATGGAGCGGCTGGAAGAGATGTGGAAGAGACTG
GAACCACTGATTGGCAAGATGGAGCCGAGTACGAGCCAGGCAGTCATTGTTGAGGTGCCAGGACTGGTGGCGTGG
CGAGAGGGCGCTGCTGCTAGGCTCCTGCTGCACGAGACGGCGGACCAAGGCCTTGTTTCAGTCTTGGCCCCGAGG
GCATCAGGGACGTTGGACAAAGAAGACGACGGGGATTCGAGGCAACTGAAATCCAAACAAAGCACGCCTGGGGCA
CGCAAACGCATGAGACCAAGCAAGACGACACACGAGGTCATCTGTAGCCTCATTGAGACTCTGCTGGAGCAGGAA
AAGGGCGTCATGATGGGCGGATGGCGGCTGGCCAAGGCGGTGAGGGCGGCCTGGCACACGACGAGTCTTGGCGAC
GCTGCGCCGCCCAGTGACAGGGAGTGCCGGGAGGCCGTCAAGAGCATGATCAAGGCCAAGGCGGTGACGGAGCAG
TGGCACGGGTTTCGCGAAGGCGGCGGCAAGGGCGCCATCTTCTCCAAGTGCCAGCTGCTGCTTGCGCCGCGGATG
GACGCCTTTTCGCCCGCGGTGCTAGCGCTGGTGGAAAAGGTCAAGGGGTCGCGGCCCGAGCTGATTGAGGGCGAA
GCAGGCGACGACGAGGGCGGCAGCGGTTCGCGGCGGCGGCGCATGTGGCGGCGGCGAGGGCGGCGGTTCCTGGGC
GACGAGGTGGTTGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGGCGAGGGCAGTGGC
GGCAATGGTGGTGGTGGTGGTGGCAGGGCAAAGCGCGTCAAGCTCTCGGCGGCGCGCAGAGGACAAGACTTGTTG
GCGCAGCCGCTGGGGCTGGACGACGTGTTGATTGCGGATCCAGAGAGACAAGAGCGGGCCATTGTGTTTGTCGAG
GCGAATGGGTGGCTGGGCGAGGCAGCTGTGGGCGAGGCAGCCGTGGCTAGAGACACACACCTCTTGATCGACCAC
CAAGCCCTCAACGACGCCCTCCAAGCAGCCCCGTCGCCTTGCCCCGACGGCTTCGTCTTTGACAGCCCCAACACC
ATCCTGGGCCACGCAGGCACCTGGCCCGCCATCAACGAAGGCCACTTTGAGCGCGTCGACGGCAGCTGGACCATG
CGCGGCTGGATGCCTGGCCCAGACTGGTTCCGCGCGGCCTCGTTTGTCGACGAGGTCGAGAAGCGCTCCCTGGTG
CGCCTCCGCGGACGCAGCCAACTGGGAGCGGCGCCCGTGTCTCGCTACCAGCGCTTCCTCTGCAGACTGCGCGCC
TGCCGCGACGTCGAGCTGGCCTGGACGTGCCTGTTTGCCAAGATGGGCTGGAGCCCGAGCCCGCGCCCGATCCAA
ATCAACTACTCGTCGGGCCCTCTTCAGCTAGCCGCCCGGCCTCCGCGCCAGACGACCTGGCCGGCCGATGAGCAG
CTGACGCCGGCAACTGCCAAGGCGCTCATCGACCAGGCCTACGAATCGTCGGCTTCATCGGACGACGCGTGGCCC
GAGCCCGCCTTTCCAAAGCCCTTGTCGTCATCGTCGTCGTCGTCGTCGCCGCCGTCGCCGCTGTCGGCTCCGCGC
CCCACTGCCCGGCCAAGGGTCAAGCGCGTTGCCCTCGTCTCTCGCGCGCTGACTGCTCTGCCGCCCAGGTCATCA
TCACCAGACGCTGCTCGACCCCGCCAGCGACCAGTCGCCGCCGACGAGGCGCGCGAGCTCATGGCAGCCTTTGTC
GCGGTGCGGGCGCTGCTGGGCGGCACGGCAAAGGCGATTGACTGGGGCCTGCTCATGACGCTCTACCCCGACATT
GAACTCGTCAGCCTGCGCCGCTTCTGGACCGATGCCACGCGGCGCCAGGGCGCATACATTGCCAACTACACGCGC
CTCCTGCACCAGCGGCTGATTGGCGCCTTTGAGGCGGACGAGCTGCCACTCATTGACTTTGACGCCATTGCCGAC
TATGACTGGCGCCGCCTGATTCGCTGGACCGTCGACCTGGTCAGCAGCCAACAAGGCCCATGGGTGCCGGCGTCG
CGAGAGGAGCTTGATAGGCACTATGCGCTGCACGCGGCCGGCAGCGCGCGGCCGGACTGGCGTGAGGCCTTTTTC
GGCGCCACCACGTCCTTTTTTGCGCGCTACGAGGCCATTACGTCGGAGCCGGGCGCCGTGCCGCTGAGCGCGCAA
GCCGTCGACGCGCCAGTCCAGCAGCAGCAAGCCGTCGATGCCGTCGACGTGGCCAAGTCGTGGGTCAAGGCCCTC
TGCGGCACCAGCGCGACGCGCTACTCGGCCGAGCAGCTCCAGCAGCAGCGCGTCGTTGCGCGCAAGGGCCGCATG
CCGCCGGGCCGCCGCCCCTTTGGCCTGAGCGAGTGGTACGCGGCGCTGCTGGCGCGCCTGGCCCAGACGCCCAAG
TACGACGACGCAGCCGCCTTCAAGGCCCGGCTCGACGCCGCCTTTGCCGCGCCCGCAACGCCCCTGCGCCGCATC
AGCCTCGTCGCCGTCGACGTGCCCCATGTGCCCCTGGGCTTCGAGCCGGGCAACTACGAAAGCCGCAAGTTTCCC
AAGTCGTACTACCACTTTGCCCTCGACGCCACCCCCACGCCCGCATACCAGCCCACGCCCGACATTCCCCTCGTC
GCCGCCGTCCAGCACGAGCCGCCGCCCTGTGCCGGCCCCTCGGGCGCGCTGCCGCAATGGGTCGACATGTTTGGC
CAGCCCCACGCCGCCTGGTCCCGCGTCGTCGGCGCCGTCTGCTTCCTCATCGCCATCCGCGGCCCCATGTCCTGC
TCCGCCATCCTCGCCGCCATGCATCCCATCCTCCACGCCTTTGAGCTGGACCTTGTCGTCGCCTGGGGCCGCCGC
ACCGGCCTCTTGGTTGATACTGCTGCCGACGGCCTAGCCATTGGCCTAACATGA
Gene >OphauG2|7576
ATGGCGCTGGATTTTGAGGAGCTGATTACGCATTTGCTGATGCTGATTGCCTGCCGCGGCGAGAATGGTGAGTGT
GTCCCTGCCCGGTAGGAGCAAGCAAGCAAGCATAGCCTTGAATATGGTGATAAAGTGCCAATGGCCAGCCTCATT
GCAATGTCTCTTATCATAGCCCCTTTGTCATCAGCAGCAAAGATGCCGTTGGACTTTTTGGGCTGACAGAGATGC
GACAGGATGTACAATCGATGAGATTATAGGAGATATCATAGAGGCAGTGAATGCCCATTGTTCCTCACCTTCAGC
TCCGAATCTAGCTCCAGACACCAAGCAATCTCTGCCGGATACAGCATGCTCTACGGTGTGGCGCTGGCTGGCGGA
TCGACAAGATGTATTGGTGGGCCGTGGGAGAGAATTCAACCATCTCTCGCTTGATGAGCTTCTCAGCCTGCCCCA
AGCCAGCACCACCACTGCTCTGGCAGCAAGTAGCACCTCTGGCACCAACAACGATGAAGCCGTCAGGGTCTTTAC
AACACAAGATACCATGTGGGAGGCCATGACGGGCCACGGCGTCGACTACAAACGCGTACCCAAGTCTGAATGGCA
GCTCCTTATTGGCATTGCAGGCAGCAGGGGGCAGGGGATCCTTCAGGGCGACTTGGGTCGCCTCACCTGCCAGGA
CAAGCGATCGGTTCCCAAGCGCACTGATGTGTTGGCCAACAAGGGCTACATCGTCAAGAGGACGACGCTGGTCAA
GGGCACCAAGACGAGCAAGATGTGGCTCAAGGCTTTGGCGCCTCCTGTGCCCAAAGAGAGTGACAGCGTGCCTAC
ACCCAGGCCCGAGTTCGATCTCTCGCGGCAGATGCTGGTGGAAAATCTGGATCCTGTGCCGTGGCACCATCGCTG
GACGGGCAGCGACATTGACTTTGAGGCTCTCGCCACGACGCTCATGGCTATCGTTAAGGAATGGGGCACATTGCG
TCTACGAGATGTCAAGCTGAAGCTGGGTGTCCTGGGCCAGCGCTGGCAGATGAAGGTGCTGGCGCAGACGTGTCG
ATTTCTCAATGCTCGCGGTGCCATTCAGTACGTGGCGGCCAAGCTTGACAATGCCGTCTTCAAGGACTGCATTTC
CTTTCGGCGCAACATGACGGCCGAGGACTGGCAACTCTTCTTGTCTACGGGGAAACGAGGCCGTGCTCTGCTGGT
GCCGTTTGGCGCCGAGGAAGAAGAAGAGGAGTGCAAGCAACAAGACAGGATTGAGTCTCAGCTGGCGTCAAGAAA
CCTCGCCAGTCAGCTGACTCCGTGGACAGTGGAAAAGCCGTTGCCGCAGACGATTATTGGCATGGTGCAGTGCAG
CGGGCCAAAGGGCCTGTCCAACTCTATTCTCCGGACCCTGACACTGGGACAGTCCTTTGGCCGCTATCTCTCTTC
GACTACCTCAGCCATGACAATAGGCAGCGAACAGCCTCGGCACCTGGCCCACCTGAAGCTGAGAAGCGAGCATGT
GAGAAACGGCAGAGACTCACGACTCTTGTTCTTTGTGGGAGAGCCAGACAAGGAGGATGCTTCTGCGTCAGCATG
TGCCCAAGAGGAACCACCAACGACGACGACGACGACAACAACAACAACAACAACAACAACAGCGGCTGCCGTTGA
GGAGCTGTATGGATTTTTGCCTGCAGCTCAGGTAGGAGCAGAGACTGCAGAGTATCATTCCCTGTCAAGTATTTG
CATTGATGGAGTATCTGTCATTGGTATAAGAAAACACCGGGGAAGACCGAGGAGAGATGAGCCAGGAGAAGGCGG
TACAGTGTCAGAGAATCCAGAAGATCCTTTATCAGTTTCGGATGAAGCTCTAGCTCAGATTCAAATGGCACAAAC
AAGAGACAATGACGAGCAGCAGCAGTGTCGCCAGCAGGGAGAAGAGCAGGAGAAGAAGGAAGAGGAAGATCAAGC
AGGACATAATGGAGAAGAAGTAGCGGAGGAGGAGAAGGAGGAAGAGCAGCACCAACAGCTGTCGCCTCGAAAGCT
CCGCGGAAAGGCCAAGCAACAGCAGGCAACCCAGTTGTCTGATCACAGCAGAGCAACACGTTCCAAGGTTGGAAC
AAGTCAACTCAATGGATTACCGGGCCAAGACCTTGGCTCAAACTCGGATGCCGCTGCAAATGGGTCTTTAAAACA
AGCGAGATCACTCGAGGAGCAAGAAATAGAGGGAGAATTTGAGCAAAAAGATGATGATGCATATGAGGAGGCAGG
CGAGGAGGCAGGGGAAGAGGCCAGTGAGGATGAGGGGGCAGGAACATCACCGGGATTACGCGGCTCGGGCAATCG
AGGCAGAGGAGGGAGGCGAGCGAAAAGAGGCAAAAGGGGCAGGGGACGGAGTCGCGGGCGGCTGCGTGGCGGCAC
GAGTAGGACAGTGCGACGACCAGCAGGGGCCGAAGCGTCAGATGCGCTGCCATGGAAATGCTCAAAGTGCGGCAA
GGGATGGAAGAACGACGTTGGCCTCAAGTATCATTTGGAAAAGTCGCAGACTGCGTGCAACCAATCATATACGGG
CGCGCCGAGGCCCGAGAAGCTAAGCAAGTCAGCCGGCATTGATGAGGCGCCAAAGGAGCGGCCGTCAAGGACGCT
GCGGCGACGGCGTGTGGATGTGGTCCAGGACAATGAAAGTGATGGCTCTGGGACCAGGGCGAGGCGTGGTGGCCG
TGGGGCAGAAAGACAAGTCAAGGCAGAGAAGAAGGTGAAGCAGCAGGAAGCAGTCATGGAGCGGCTGGAAGAGAT
GTGGAAGAGACTGGAACCACTGATTGGCAAGATGGAGCCGAGTACGAGCCAGGCAGTCATTGTTGAGGTGCCAGG
ACTGGTGGCGTGGCGAGAGGGCGCTGCTGCTAGGCTCCTGCTGCACGAGACGGCGGACCAAGGCCTTGTTTCAGT
CTTGGCCCCGAGGGCATCAGGGACGTTGGACAAAGAAGACGACGGGGATTCGAGGCAACTGAAATCCAAACAAAG
CACGCCTGGGGCACGCAAACGCATGAGACCAAGCAAGACGACACACGAGGTCATCTGTAGCCTCATTGAGACTCT
GCTGGAGCAGGAAAAGGGCGTCATGATGGGCGGATGGCGGCTGGCCAAGGCGGTGAGGGCGGCCTGGCACACGAC
GAGTCTTGGCGACGCTGCGCCGCCCAGTGACAGGGAGTGCCGGGAGGCCGTCAAGAGCATGATCAAGGCCAAGGC
GGTGACGGAGCAGTGGCACGGGTTTCGCGAAGGCGGCGGCAAGGGCGCCATCTTCTCCAAGTGCCAGCTGCTGCT
TGCGCCGCGGATGGACGCCTTTTCGCCCGCGGTGCTAGCGCTGGTGGAAAAGGTCAAGGGGTCGCGGCCCGAGCT
GATTGAGGGCGAAGCAGGCGACGACGAGGGCGGCAGCGGTTCGCGGCGGCGGCGCATGTGGCGGCGGCGAGGGCG
GCGGTTCCTGGGCGACGAGGTGGTTGATCTGGAGGCGCCCGTGTATGCGGCCAAGTTGGCGAGCAAGAGGGCGGG
CGAGGGCAGTGGCGGCAATGGTGGTGGTGGTGGTGGCAGGGCAAAGCGCGTCAAGCTCTCGGCGGCGCGCAGAGG
ACAAGACTTGTTGGCGCAGCCGCTGGGGCTGGACGACGTGTTGATTGCGGATCCAGAGAGACAAGAGCGGGCCAT
TGTGTTTGTCGAGGCGAATGGGTGGCTGGGCGAGGCAGCTGTGGGCGAGGCAGCCGTGGCTAGAGACACACACCT
CTTGATCGACCACCAAGCCCTCAACGACGCCCTCCAAGCAGCCCCGTCGCCTTGCCCCGACGGCTTCGTCTTTGA
CAGCCCCAACACCATCCTGGGCCACGCAGGCACCTGGCCCGCCATCAACGAAGGCCACTTTGAGCGCGTCGACGG
CAGCTGGACCATGCGCGGCTGGATGCCTGGCCCAGACTGGTTCCGCGCGGCCTCGTTTGTCGACGAGGTCGAGAA
GCGCTCCCTGGTGCGCCTCCGCGGACGCAGCCAACTGGGAGCGGCGCCCGTGTCTCGCTACCAGCGCTTCCTCTG
CAGACTGCGCGCCTGCCGCGACGTCGAGCTGGCCTGGACGTGCCTGTTTGCCAAGATGGGCTGGAGCCCGAGCCC
GCGCCCGATCCAAATCAACTACTCGTCGGGCCCTCTTCAGCTAGCCGCCCGGCCTCCGCGCCAGACGACCTGGCC
GGCCGATGAGCAGCTGACGCCGGCAACTGCCAAGGCGCTCATCGACCAGGCCTACGAATCGTCGGCTTCATCGGA
CGACGCGTGGCCCGAGCCCGCCTTTCCAAAGCCCTTGTCGTCATCGTCGTCGTCGTCGTCGCCGCCGTCGCCGCT
GTCGGCTCCGCGCCCCACTGCCCGGCCAAGGGTCAAGCGCGTTGCCCTCGTCTCTCGCGCGCTGACTGCTCTGCC
GCCCAGGTCATCATCACCAGACGCTGCTCGACCCCGCCAGCGACCAGTCGCCGCCGACGAGGCGCGCGAGCTCAT
GGCAGCCTTTGTCGCGGTGCGGGCGCTGCTGGGCGGCACGGCAAAGGCGATTGACTGGGGCCTGCTCATGACGCT
CTACCCCGACATTGAACTCGTCAGCCTGCGCCGCTTCTGGACCGATGCCACGCGGCGCCAGGGCGCATACATTGC
CAACTACACGCGCCTCCTGCACCAGCGGCTGATTGGCGCCTTTGAGGCGGACGAGCTGCCACTCATTGACTTTGA
CGCCATTGCCGACTATGACTGGCGCCGCCTGATTCGCTGGACCGTCGACCTGGTCAGCAGCCAACAAGGCCCATG
GGTGCCGGCGTCGCGAGAGGAGCTTGATAGGCACTATGCGCTGCACGCGGCCGGCAGCGCGCGGCCGGACTGGCG
TGAGGCCTTTTTCGGCGCCACCACGTCCTTTTTTGCGCGCTACGAGGCCATTACGTCGGAGCCGGGCGCCGTGCC
GCTGAGCGCGCAAGCCGTCGACGCGCCAGTCCAGCAGCAGCAAGCCGTCGATGCCGTCGACGTGGCCAAGTCGTG
GGTCAAGGCCCTCTGCGGCACCAGCGCGACGCGCTACTCGGCCGAGCAGGTGCGCGCGCGCCTGCGCACTCTCTG
CCCCGGCGACCGCCAGGCCTCGTCGGCCCTCTTCAAAACAGCCGTGGCGCAGCTCCAGCAGCAGCGCGTCGTTGC
GCGCAAGGGCCGCATGCCGCCGGGCCGCCGCCCCTTTGGCCTGAGCGAGTGGTACGCGGCGCTGCTGGCGCGCCT
GGCCCAGACGCCCAAGTACGACGACGCAGCCGCCTTCAAGGCCCGGCTCGACGCCGCCTTTGCCGCGCCCGCAAC
GCCCCTGCGCGTGCCGTACACGCTGAGCGACGGCGCCACCATGGCGCTCACCAACCTCGCCGCCCACCAGCGCAT
CAGCCTCGTCGCCGTCGACGTGCCCCATGTGCCCCTGGGCTTCGAGCCGGGCAACTACGAAAGCCGCAAGTTTCC
CAAGTCGTACTACCACTTTGCCCTCGACGCCACCCCCACGCCCGCATACCAGCCCACGCCCGACATTCCCCTCGT
CGCCGCCGTCCAGCACGAGCCGCCGCCCTGTGCCGGCCCCTCGGGCGCGCTGCCGCAATGGGTCGACATGTTTGG
CCAGCCCCACGCCGCCTGGTCCCGCGTCGTCGGCGCCGTCTGCTTCCTCATCGCCATCCGCGGCCCCATGTCCTG
CTCCGCCATCCTCGCCGCCATGCATCCCATCCTCCACGCCTTTGAGCTGGACCTTGTCGTCGCCTGGGGCCGCCG
CACCGGCCTCTTGGTTGATACTGCTGCCGACGGCCTAGCCATTGGCGTCTCCGAGTGGTGGTGGCTGGCTGTGCC
CTTGATGCCCCAGCTAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail