Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7568
Gene name
LocationContig_9:5984..7339
Strand+
Gene length (bp)1355
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 7.3E-70 51 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 17 323 1.0E-50
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 42 323 3.0E-50
sp|Q54CS7|JMJCE_DICDI JmjC domain-containing protein E OS=Dictyostelium discoideum GN=jcdE PE=3 SV=2 40 336 1.0E-42
sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 53 300 3.0E-08
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 54 300 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 17 323 1.0E-50
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 42 323 3.0E-50
sp|Q54CS7|JMJCE_DICDI JmjC domain-containing protein E OS=Dictyostelium discoideum GN=jcdE PE=3 SV=2 40 336 1.0E-42
sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 53 300 3.0E-08
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 54 300 6.0E-08
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 48 300 7.0E-08
sp|Q8BK58|HBAP1_MOUSE HSPB1-associated protein 1 OS=Mus musculus GN=Hspbap1 PE=1 SV=2 73 322 8.0E-08
sp|Q5BKC6|HBAP1_RAT HSPB1-associated protein 1 OS=Rattus norvegicus GN=Hspbap1 PE=1 SV=1 73 322 2.0E-07
sp|Q96EW2|HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens GN=HSPBAP1 PE=1 SV=1 76 322 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7568
MAALDPARNAARNAARNAALDAAFTHLVTAFNHLNGPSLVELHSEPSPLDFMRFVARNSPFVIRRAAAHWKATQK
WSAAHLVAALEGQTINVAVTPNGNADAPVFSPPHNATLFAKPLEESHFFKDFLAYIINQESDATFDQSAEVRYAQ
TQNDNLRDEYSTLFPDAQKDIPFARIALQKPPEAINLWIGNSRSVTAIHKDNFENIYVQIRGRKHFTLFPPLCQP
CMNEKLLPSATYIRHANGTLSLQLDDDAQSVPFATWDPDEPENHATQWSSLAMPMRVTLEPGDMLYLPAMWYHKV
TQSCIPDDEPFVAAINYWYDMEYSGTLYPLTSFLRKLDHLPTGEEPSIL*
Coding >OphauG2|7568
ATGGCAGCCTTGGATCCTGCCCGCAATGCAGCCCGCAATGCAGCCCGCAATGCAGCTCTTGATGCAGCCTTTACC
CATCTCGTCACCGCCTTCAACCACCTCAACGGCCCCTCCCTTGTCGAGCTCCATTCCGAGCCGAGCCCCCTCGAC
TTTATGCGATTCGTTGCCCGCAACTCGCCTTTTGTTATCCGCCGTGCCGCTGCCCATTGGAAAGCCACCCAGAAG
TGGTCTGCTGCACATCTCGTAGCCGCCCTCGAGGGCCAGACCATCAATGTCGCCGTCACTCCCAACGGCAATGCC
GACGCTCCAGTCTTTTCCCCTCCTCACAACGCAACCCTCTTCGCTAAGCCTCTGGAGGAATCTCACTTCTTCAAA
GACTTTCTCGCCTACATTATCAACCAGGAATCAGATGCTACTTTTGACCAATCCGCCGAGGTGAGGTACGCCCAG
ACCCAAAATGATAATCTGCGTGACGAGTACTCGACTCTCTTCCCCGATGCTCAAAAAGACATTCCATTTGCCCGC
ATTGCTCTTCAGAAACCCCCCGAAGCCATTAACCTCTGGATCGGCAACTCACGTTCCGTCACAGCAATTCACAAA
GACAACTTTGAAAACATCTATGTTCAAATCCGCGGCCGCAAGCACTTTACCCTCTTTCCTCCACTGTGTCAGCCA
TGCATGAATGAGAAACTGCTGCCTTCAGCCACCTATATTCGCCATGCCAATGGCACCCTGTCTCTCCAGCTTGAT
GACGACGCCCAGTCCGTACCCTTTGCCACCTGGGATCCCGACGAACCCGAAAACCATGCTACCCAGTGGTCTTCA
CTCGCAATGCCCATGCGTGTCACCCTTGAGCCAGGCGATATGCTCTATCTTCCAGCCATGTGGTATCATAAAGTC
ACGCAATCCTGCATACCGGACGACGAGCCCTTTGTGGCCGCGATAAATTACTGGTACGACATGGAGTATAGCGGC
ACGCTCTACCCGTTGACCTCATTTCTACGCAAGCTTGACCACTTGCCGACAGGCGAGGAACCATCAATACTCTAA
Transcript >OphauG2|7568
ATGGCAGCCTTGGATCCTGCCCGCAATGCAGCCCGCAATGCAGCCCGCAATGCAGCTCTTGATGCAGCCTTTACC
CATCTCGTCACCGCCTTCAACCACCTCAACGGCCCCTCCCTTGTCGAGCTCCATTCCGAGCCGAGCCCCCTCGAC
TTTATGCGATTCGTTGCCCGCAACTCGCCTTTTGTTATCCGCCGTGCCGCTGCCCATTGGAAAGCCACCCAGAAG
TGGTCTGCTGCACATCTCGTAGCCGCCCTCGAGGGCCAGACCATCAATGTCGCCGTCACTCCCAACGGCAATGCC
GACGCTCCAGTCTTTTCCCCTCCTCACAACGCAACCCTCTTCGCTAAGCCTCTGGAGGAATCTCACTTCTTCAAA
GACTTTCTCGCCTACATTATCAACCAGGAATCAGATGCTACTTTTGACCAATCCGCCGAGGTGAGGTACGCCCAG
ACCCAAAATGATAATCTGCGTGACGAGTACTCGACTCTCTTCCCCGATGCTCAAAAAGACATTCCATTTGCCCGC
ATTGCTCTTCAGAAACCCCCCGAAGCCATTAACCTCTGGATCGGCAACTCACGTTCCGTCACAGCAATTCACAAA
GACAACTTTGAAAACATCTATGTTCAAATCCGCGGCCGCAAGCACTTTACCCTCTTTCCTCCACTGTGTCAGCCA
TGCATGAATGAGAAACTGCTGCCTTCAGCCACCTATATTCGCCATGCCAATGGCACCCTGTCTCTCCAGCTTGAT
GACGACGCCCAGTCCGTACCCTTTGCCACCTGGGATCCCGACGAACCCGAAAACCATGCTACCCAGTGGTCTTCA
CTCGCAATGCCCATGCGTGTCACCCTTGAGCCAGGCGATATGCTCTATCTTCCAGCCATGTGGTATCATAAAGTC
ACGCAATCCTGCATACCGGACGACGAGCCCTTTGTGGCCGCGATAAATTACTGGTACGACATGGAGTATAGCGGC
ACGCTCTACCCGTTGACCTCATTTCTACGCAAGCTTGACCACTTGCCGACAGGCGAGGAACCATCAATACTCTAA
Gene >OphauG2|7568
ATGGCAGCCTTGGATCCTGCCCGCAATGCAGCCCGCAATGCAGCCCGCAATGCAGCTCTTGATGCAGCCTTTACC
CATCTCGTCACCGCCTTCAACCACCTCAACGGCCCCTCCCTTGTCGAGCTCCATTCCGAGCCGAGCCCCCTCGAC
TTTATGCGATTCGTTGCCCGCAACTCGCCTTTTGTTATCCGCCGTGCCGCTGCCCATTGGAAAGCCACCCAGAAG
TGGTCTGCTGCACATCTCGTAGCCGCCCTCGAGGGCCAGACCATCAATGTCGCCGTCACTCCCAACGGGTACGCC
TCCTCTTATCTAGTCTCTTTATCCATACCCATACTCCCTACAGACCCTCCCTACATGCTATGCTGCTGCTCTCTC
CATCCCTGACCTCATTTAACTCACGACTCTAGCAATGCCGACGCTCCAGTCTTTTCCCCTCCTCACAACGCAACC
CTCTTCGCTAAGCCTCTGGAGGAATCTCACTTCTTCAAAGACTTTCTCGCCTACATTATCAACCAGGAATCAGAT
GCTACTTTTGACCAATCCGCCGAGGTGAGGTACGCCCAGACCCGTCAGTCTCATCTCCTCTCACTCTTCCTCACC
CATACTCATCAAGTCTTTCAAGAAAATGATAATCTGCGTGACGAGTACTCGACTCTCTTCCCCGATGCTCAAAAA
GACATTCCATTTGCCCGCATTGCTCTTCAGAAACCCCCCGAAGCCATTAACCTCTGGATCGGCAACTCACGTTCC
GTCACAGCAATTCACAAAGACAACTTTGAAAACATCTATGTTCAAATCCGCGGCCGCAAGCACTTTACCCTCTTT
CCTCCACTGTGTCAGCCATGCATGAATGAGAAACTGCTGCCTTCAGCCACCTATATTCGCCATGCCAATGGCACC
CTGTCTCTCCAGCTTGATGACGACGCCCAGTCCGTACCCTTTGCCACCTGGGATCCCGACGAACCCGAAAACCAT
GCTACCCAGTGGTCTTCACTCGCAATGCCCATGCGTGTCACCCTTGAGCCAGGCGATATGCTCTATCTTCCAGCC
ATGTGGTGAGTCAAAATCCGCGCCCGTCGTAAAACTCCACTCAGACCTCGTTAATATCCGAAGCAGGTATCATAA
AGTCACGCAATCCTGCATACCGGACGACGAGCCCTTTGTGGCCGCGATAAATTACTGGTCAGTTGACCTTCATCT
GACCTTTCCACGGTTCACTTGCTGTCCTCCTGACACTTGTATTGCTGACTCGAACCAGGTACGACATGGAGTATA
GCGGCACGCTCTACCCGTTGACCTCATTTCTACGCAAGCTTGACCACTTGCCGACAGGCGAGGAACCATCAATAC
TCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail