Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7567
Gene name
LocationContig_9:1453..4965
Strand-
Gene length (bp)3512
Transcript length (bp)3372
Coding sequence length (bp)3372
Protein length (aa) 1124

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 1.1E-36 315 456
PF02460 Patched Patched family 8.8E-10 294 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 164 457 4.0E-25
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 164 457 4.0E-25
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 164 457 5.0E-25
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 166 457 8.0E-24
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 166 457 8.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 164 457 4.0E-25
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 164 457 4.0E-25
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 164 457 5.0E-25
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 166 457 8.0E-24
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 166 457 8.0E-24
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 164 457 1.0E-23
sp|O43043|SCAP_SCHPO Sterol regulatory element-binding protein cleavage-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scp1 PE=1 SV=1 304 1120 4.0E-23
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 164 457 2.0E-21
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 280 452 4.0E-10
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 287 454 3.0E-08
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 287 454 2.0E-07
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 287 454 3.0E-07
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 243 452 8.0E-07
sp|Q9UHC9|NPCL1_HUMAN Niemann-Pick C1-like protein 1 OS=Homo sapiens GN=NPC1L1 PE=1 SV=2 217 454 2.0E-06
sp|Q12649|HMDH_PHYB8 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=hmgA PE=3 SV=2 172 455 5.0E-06
sp|Q3KNS1|PTHD3_HUMAN Patched domain-containing protein 3 OS=Homo sapiens GN=PTCHD3 PE=1 SV=3 275 452 7.0E-06
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 222 452 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 286 308 22
3 321 343 22
4 426 448 22
5 494 513 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7567
MIWYLLYPLRGTTEPPVLPPSHLLHRALSHYGRCAARHVVATLLVSAAVATMLLYPIPFLFTSDFTNGASNLPHH
VWTAARPLPYDAAAKPKIIMRSVWFHASYMKALNVDLLTAALDVQDDLLGTTKNFSPARAHKHALAPHHAKPGNA
SLTLAQRDALHVANGLTDEAWFFHSPLLYWGCSNDRILADTDILATVNNKKNQSTSANVTLRHSIVFSGKRFEER
RLLAADALVITLLHLGNSPVGREWEKRARQLPTRAAKLWDVYPPDGHVTTSQLYEFQFRPISVQDITSLALAYLM
TIVYLLVSLSKLRAVKSKFGLIVTIVTQIVFSIMSSFTVCAVFKIDLSHIPRAAYPLVVLSMSLENIIRLINAVI
LTPFEDSVSNRIGQAFGETAPTAFASTVQNCFLLVFLSRLVSSGVSEFCVFTAVAIVFDFFYLSTFFLAVLSLDV
RRMELGDALAKSAMRHNRDRGNRGQSPSWWHQLIHENVAMSTRIAGTIIMLGFVLIAQWHFLADEGLLRKLLRLY
RICDATMPSGLPRTTLLEDIHQARSPMSWLRMQDHETAREVINIIKPSAYSYVARVFDPLVLVLKDADRTPHTNE
RALLPAVYDFINHELTRFAVIVIVIIASLRLLTNYLLWGEDEQSLPDQHDAEKAPIMSVKSLPGHRMDIVVMATS
ANGDIVTASIDSTLRVWSIRGIGNSYLISKGNETAASLFPVGTLAIDDTSTWVAVQTRPKGQTLGKVTMWNLRDH
FWSPSVHSNSCRERPTAFFFDPSASRAEPRAIIVNQDGTLTEVSAGTLPERGPLAVFPPELKCARVVAIKEDDEF
ASQSVIMAVSKQGAVHLATRSHGHWKPRRLALEGLGISNTHSIEVLPAIELFIVSAKNCVYLIGAQDGSVLHTIK
TTDKLLRPLRCAYTSHGASMPGTIGLASFSLAYVEAGSKDCVLQTILPPENCDAIYLRAPSDASGSDWCTWDSAV
EKWKRVTNPGSWDIISDGTAVGIRCRQPTMAAQQEAASSGLRNRHAKRSRETDVFGCWQVWTATPAGRCDADDTQ
RLVKEGEEDKHLWISSLGPEGRVGINSVGFVFGNLVKLVVIGGPAKLADNLDEVNTGSRRRKPGSASRARVAV*
Coding >OphauG2|7567
ATGATCTGGTACCTCCTATATCCCTTGCGAGGGACCACTGAGCCGCCTGTGCTCCCTCCCTCACACCTGCTTCAC
CGAGCCCTGTCGCATTATGGCCGATGTGCCGCCCGCCATGTCGTCGCCACCCTGCTCGTCTCGGCCGCCGTGGCC
ACCATGCTGCTCTATCCCATACCCTTTCTCTTCACCAGCGACTTCACCAACGGCGCCTCCAACCTGCCTCACCAC
GTCTGGACTGCTGCCCGCCCTCTGCCCTATGATGCCGCCGCCAAGCCCAAGATTATTATGCGCTCTGTCTGGTTT
CATGCCAGCTACATGAAGGCTCTCAATGTCGACCTGCTCACCGCTGCCCTCGACGTTCAGGATGACCTCCTCGGC
ACCACCAAGAACTTTAGTCCCGCTCGCGCCCACAAGCACGCTCTGGCCCCCCACCACGCCAAACCTGGCAACGCC
TCTCTGACGTTGGCCCAGCGCGATGCCCTACACGTCGCCAATGGCCTCACGGATGAAGCCTGGTTCTTCCATTCT
CCCCTCTTGTACTGGGGCTGCTCCAATGACCGCATTCTTGCCGACACTGACATCCTCGCCACTGTCAACAACAAG
AAGAACCAGTCCACCTCGGCAAACGTTACCCTCCGCCACTCCATTGTTTTTAGTGGCAAACGCTTCGAGGAACGC
CGCCTCTTGGCCGCCGATGCTCTCGTCATCACCCTTTTGCACTTGGGCAACTCACCCGTCGGCCGTGAGTGGGAG
AAGCGTGCTCGCCAGCTGCCCACAAGAGCTGCCAAGCTGTGGGATGTCTACCCCCCAGATGGACATGTCACCACG
AGCCAGCTCTACGAGTTTCAGTTTCGCCCCATTTCAGTCCAAGACATTACCAGCTTGGCTCTCGCCTACCTCATG
ACCATTGTCTATCTTCTCGTTAGCCTGTCCAAGCTGCGAGCCGTAAAGTCCAAGTTTGGCCTCATTGTCACCATT
GTAACCCAGATTGTCTTCTCCATCATGTCCAGCTTCACCGTCTGCGCCGTCTTCAAGATAGATTTGTCCCATATT
CCACGCGCTGCATATCCTCTAGTTGTTCTCTCCATGAGTCTGGAAAACATTATTCGCCTCATCAATGCAGTCATT
CTCACTCCCTTTGAGGACAGCGTCAGCAACAGGATCGGCCAAGCCTTTGGCGAGACGGCACCCACTGCTTTTGCC
AGCACGGTACAAAACTGCTTCTTGCTGGTGTTTTTGTCTCGCCTTGTCTCGTCGGGCGTCTCAGAATTCTGCGTC
TTCACTGCCGTGGCAATAGTATTTGACTTTTTCTACCTGTCAACTTTTTTCCTCGCCGTCTTGAGCCTTGATGTC
CGACGCATGGAACTTGGAGACGCGCTGGCAAAGTCGGCAATGCGGCATAATCGCGACCGAGGCAACCGTGGCCAG
AGCCCCTCTTGGTGGCATCAGCTTATTCACGAAAACGTTGCCATGTCGACGCGCATTGCGGGCACCATTATTATG
CTCGGCTTTGTTCTCATTGCCCAGTGGCACTTTTTGGCCGATGAGGGCCTCTTGAGGAAGTTGTTGCGTCTCTAC
AGGATTTGTGATGCAACAATGCCCTCTGGTCTACCGCGCACCACGTTACTGGAGGATATCCATCAGGCGAGGAGC
CCCATGTCATGGCTGCGCATGCAGGACCATGAGACGGCCCGGGAAGTCATCAATATAATCAAGCCGTCGGCCTAT
AGCTACGTGGCTCGCGTTTTCGATCCTTTGGTCCTGGTTCTCAAGGATGCGGATCGAACGCCTCACACCAATGAG
CGGGCTCTATTGCCCGCCGTCTACGATTTCATCAATCACGAGCTGACGCGCTTCGCCGTCATCGTCATAGTCATT
ATAGCCTCCCTAAGGCTGCTGACCAATTATCTTCTTTGGGGAGAAGATGAGCAGAGCCTACCAGATCAACATGAT
GCCGAAAAGGCTCCCATCATGTCGGTCAAGTCACTTCCTGGTCACCGCATGGATATTGTTGTCATGGCAACCTCT
GCCAATGGCGACATTGTCACGGCTTCTATAGATTCGACTCTTCGTGTTTGGTCGATTCGTGGAATTGGTAACAGT
TATCTCATCTCCAAGGGAAACGAGACGGCAGCATCACTGTTTCCCGTTGGCACCTTGGCCATTGACGACACGTCG
ACGTGGGTGGCGGTTCAAACGCGCCCCAAAGGACAGACGCTTGGCAAGGTGACGATGTGGAATCTCCGGGACCAT
TTCTGGAGCCCGTCTGTCCATAGCAACAGCTGCAGGGAGAGACCAACAGCCTTCTTCTTTGATCCAAGCGCCTCA
CGCGCAGAGCCTCGAGCCATCATAGTCAACCAAGACGGCACCTTGACAGAAGTGTCGGCGGGCACGTTACCCGAG
CGCGGCCCGCTTGCCGTCTTTCCTCCAGAGCTCAAGTGCGCTCGCGTGGTAGCCATCAAAGAGGACGACGAATTT
GCCTCTCAATCGGTAATCATGGCTGTGTCAAAGCAGGGAGCCGTTCATCTGGCGACGCGCAGCCATGGTCATTGG
AAACCTCGGCGCTTAGCGCTTGAGGGCCTGGGGATTTCAAACACTCACAGCATCGAGGTTTTGCCTGCCATTGAG
CTGTTCATTGTGTCAGCCAAGAATTGTGTCTATTTGATAGGGGCACAGGATGGAAGCGTTTTGCACACCATTAAA
ACGACAGACAAGCTTCTTAGGCCGTTGAGGTGTGCATATACATCTCACGGAGCCTCTATGCCTGGCACCATTGGA
CTTGCGTCATTTAGCCTGGCCTATGTAGAAGCTGGATCAAAGGACTGCGTTTTACAAACGATTTTGCCGCCTGAG
AATTGTGACGCCATCTACCTACGAGCGCCATCGGATGCTAGTGGCAGCGACTGGTGTACCTGGGACTCGGCAGTG
GAGAAGTGGAAGCGTGTGACAAATCCTGGCTCGTGGGACATCATTTCGGACGGCACAGCGGTTGGAATTCGATGC
CGGCAGCCAACTATGGCGGCGCAGCAAGAGGCTGCCTCGTCTGGGCTGCGCAACCGACACGCCAAACGATCTCGC
GAAACAGATGTTTTTGGATGCTGGCAGGTGTGGACGGCGACGCCAGCTGGGCGATGTGACGCCGACGACACTCAA
CGGCTGGTCAAGGAAGGCGAGGAGGACAAGCATTTGTGGATTTCTAGTCTTGGGCCCGAAGGGCGCGTGGGCATC
AACTCTGTTGGATTCGTCTTTGGCAACTTGGTGAAACTTGTTGTGATTGGTGGACCAGCAAAGCTTGCCGACAAT
CTGGACGAGGTGAATACAGGCAGCAGGAGACGAAAGCCGGGCAGCGCGTCTCGCGCCAGAGTTGCAGTCTAG
Transcript >OphauG2|7567
ATGATCTGGTACCTCCTATATCCCTTGCGAGGGACCACTGAGCCGCCTGTGCTCCCTCCCTCACACCTGCTTCAC
CGAGCCCTGTCGCATTATGGCCGATGTGCCGCCCGCCATGTCGTCGCCACCCTGCTCGTCTCGGCCGCCGTGGCC
ACCATGCTGCTCTATCCCATACCCTTTCTCTTCACCAGCGACTTCACCAACGGCGCCTCCAACCTGCCTCACCAC
GTCTGGACTGCTGCCCGCCCTCTGCCCTATGATGCCGCCGCCAAGCCCAAGATTATTATGCGCTCTGTCTGGTTT
CATGCCAGCTACATGAAGGCTCTCAATGTCGACCTGCTCACCGCTGCCCTCGACGTTCAGGATGACCTCCTCGGC
ACCACCAAGAACTTTAGTCCCGCTCGCGCCCACAAGCACGCTCTGGCCCCCCACCACGCCAAACCTGGCAACGCC
TCTCTGACGTTGGCCCAGCGCGATGCCCTACACGTCGCCAATGGCCTCACGGATGAAGCCTGGTTCTTCCATTCT
CCCCTCTTGTACTGGGGCTGCTCCAATGACCGCATTCTTGCCGACACTGACATCCTCGCCACTGTCAACAACAAG
AAGAACCAGTCCACCTCGGCAAACGTTACCCTCCGCCACTCCATTGTTTTTAGTGGCAAACGCTTCGAGGAACGC
CGCCTCTTGGCCGCCGATGCTCTCGTCATCACCCTTTTGCACTTGGGCAACTCACCCGTCGGCCGTGAGTGGGAG
AAGCGTGCTCGCCAGCTGCCCACAAGAGCTGCCAAGCTGTGGGATGTCTACCCCCCAGATGGACATGTCACCACG
AGCCAGCTCTACGAGTTTCAGTTTCGCCCCATTTCAGTCCAAGACATTACCAGCTTGGCTCTCGCCTACCTCATG
ACCATTGTCTATCTTCTCGTTAGCCTGTCCAAGCTGCGAGCCGTAAAGTCCAAGTTTGGCCTCATTGTCACCATT
GTAACCCAGATTGTCTTCTCCATCATGTCCAGCTTCACCGTCTGCGCCGTCTTCAAGATAGATTTGTCCCATATT
CCACGCGCTGCATATCCTCTAGTTGTTCTCTCCATGAGTCTGGAAAACATTATTCGCCTCATCAATGCAGTCATT
CTCACTCCCTTTGAGGACAGCGTCAGCAACAGGATCGGCCAAGCCTTTGGCGAGACGGCACCCACTGCTTTTGCC
AGCACGGTACAAAACTGCTTCTTGCTGGTGTTTTTGTCTCGCCTTGTCTCGTCGGGCGTCTCAGAATTCTGCGTC
TTCACTGCCGTGGCAATAGTATTTGACTTTTTCTACCTGTCAACTTTTTTCCTCGCCGTCTTGAGCCTTGATGTC
CGACGCATGGAACTTGGAGACGCGCTGGCAAAGTCGGCAATGCGGCATAATCGCGACCGAGGCAACCGTGGCCAG
AGCCCCTCTTGGTGGCATCAGCTTATTCACGAAAACGTTGCCATGTCGACGCGCATTGCGGGCACCATTATTATG
CTCGGCTTTGTTCTCATTGCCCAGTGGCACTTTTTGGCCGATGAGGGCCTCTTGAGGAAGTTGTTGCGTCTCTAC
AGGATTTGTGATGCAACAATGCCCTCTGGTCTACCGCGCACCACGTTACTGGAGGATATCCATCAGGCGAGGAGC
CCCATGTCATGGCTGCGCATGCAGGACCATGAGACGGCCCGGGAAGTCATCAATATAATCAAGCCGTCGGCCTAT
AGCTACGTGGCTCGCGTTTTCGATCCTTTGGTCCTGGTTCTCAAGGATGCGGATCGAACGCCTCACACCAATGAG
CGGGCTCTATTGCCCGCCGTCTACGATTTCATCAATCACGAGCTGACGCGCTTCGCCGTCATCGTCATAGTCATT
ATAGCCTCCCTAAGGCTGCTGACCAATTATCTTCTTTGGGGAGAAGATGAGCAGAGCCTACCAGATCAACATGAT
GCCGAAAAGGCTCCCATCATGTCGGTCAAGTCACTTCCTGGTCACCGCATGGATATTGTTGTCATGGCAACCTCT
GCCAATGGCGACATTGTCACGGCTTCTATAGATTCGACTCTTCGTGTTTGGTCGATTCGTGGAATTGGTAACAGT
TATCTCATCTCCAAGGGAAACGAGACGGCAGCATCACTGTTTCCCGTTGGCACCTTGGCCATTGACGACACGTCG
ACGTGGGTGGCGGTTCAAACGCGCCCCAAAGGACAGACGCTTGGCAAGGTGACGATGTGGAATCTCCGGGACCAT
TTCTGGAGCCCGTCTGTCCATAGCAACAGCTGCAGGGAGAGACCAACAGCCTTCTTCTTTGATCCAAGCGCCTCA
CGCGCAGAGCCTCGAGCCATCATAGTCAACCAAGACGGCACCTTGACAGAAGTGTCGGCGGGCACGTTACCCGAG
CGCGGCCCGCTTGCCGTCTTTCCTCCAGAGCTCAAGTGCGCTCGCGTGGTAGCCATCAAAGAGGACGACGAATTT
GCCTCTCAATCGGTAATCATGGCTGTGTCAAAGCAGGGAGCCGTTCATCTGGCGACGCGCAGCCATGGTCATTGG
AAACCTCGGCGCTTAGCGCTTGAGGGCCTGGGGATTTCAAACACTCACAGCATCGAGGTTTTGCCTGCCATTGAG
CTGTTCATTGTGTCAGCCAAGAATTGTGTCTATTTGATAGGGGCACAGGATGGAAGCGTTTTGCACACCATTAAA
ACGACAGACAAGCTTCTTAGGCCGTTGAGGTGTGCATATACATCTCACGGAGCCTCTATGCCTGGCACCATTGGA
CTTGCGTCATTTAGCCTGGCCTATGTAGAAGCTGGATCAAAGGACTGCGTTTTACAAACGATTTTGCCGCCTGAG
AATTGTGACGCCATCTACCTACGAGCGCCATCGGATGCTAGTGGCAGCGACTGGTGTACCTGGGACTCGGCAGTG
GAGAAGTGGAAGCGTGTGACAAATCCTGGCTCGTGGGACATCATTTCGGACGGCACAGCGGTTGGAATTCGATGC
CGGCAGCCAACTATGGCGGCGCAGCAAGAGGCTGCCTCGTCTGGGCTGCGCAACCGACACGCCAAACGATCTCGC
GAAACAGATGTTTTTGGATGCTGGCAGGTGTGGACGGCGACGCCAGCTGGGCGATGTGACGCCGACGACACTCAA
CGGCTGGTCAAGGAAGGCGAGGAGGACAAGCATTTGTGGATTTCTAGTCTTGGGCCCGAAGGGCGCGTGGGCATC
AACTCTGTTGGATTCGTCTTTGGCAACTTGGTGAAACTTGTTGTGATTGGTGGACCAGCAAAGCTTGCCGACAAT
CTGGACGAGGTGAATACAGGCAGCAGGAGACGAAAGCCGGGCAGCGCGTCTCGCGCCAGAGTTGCAGTCTAG
Gene >OphauG2|7567
ATGATCTGGTACCTCCTATATCCCTTGCGAGGGTGAGTCTGCCCACCTGGGCCTGCCCACCGCACCCTCCCCAGT
ACTGACTCCCGAGTACTGACATGAGCAGGACCACTGAGCCGCCTGTGCTCCCTCCCTCACACCTGCTTCACCGAG
CCCTGTCGCATTATGGCCGATGTGCCGCCCGCCATGTCGTCGCCACCCTGCTCGTCTCGGCCGCCGTGGCCACCA
TGCTGCTCTATCCCATACCCTTTCTCTTCACCAGCGACTTCACCAACGGCGCCTCCAACCTGCCTCACCACGTCT
GGACTGCTGCCCGCCCTCTGCCCTATGATGCCGCCGCCAAGCCCAAGATTATTATGCGCTCTGTCTGGTTTCATG
CCAGCTACATGAAGGCTCTCAATGTCGACCTGCTCACCGCTGCCCTCGACGTTCAGGATGACCTCCTCGGCACCA
CCAAGAACTTTAGTCCCGCTCGCGCCCACAAGCACGCTCTGGCCCCCCACCACGCCAAACCTGGCAACGCCTCTC
TGACGTTGGCCCAGCGCGATGCCCTACACGTCGCCAATGGCCTCACGGATGAAGCCTGGTTCTTCCATTCTCCCC
TCTTGTACTGGGGCTGCTCCAATGACCGCATTCTTGCCGACACTGACATCCTCGCCACTGTCAACAACAAGAAGA
ACCAGTCCACCTCGGCAAACGTTACCCTCCGCCACTCCATTGTTTTTAGTGGCAAACGCTTCGAGGAACGCCGCC
TCTTGGCCGCCGATGCTCTCGTCATCACCCTTTTGCACTTGGGCAACTCACCCGTCGGCCGTGAGTGGGAGAAGC
GTGCTCGCCAGCTGCCCACAAGAGCTGCCAAGCTGTGGGATGTCTACCCCCCAGATGGACATGTCACCACGAGCC
AGCTCTACGAGTTTCAGTTTCGCCCCATTTCAGTCCAAGACATTACCAGCTTGGCTCTCGCCTACCTCATGACCA
TTGTCTATCTTCTCGTTAGCCTGTCCAAGCTGCGAGCCGTAAAGTCCAAGTTTGGCCTCATTGTCACCATTGTAA
CCCAGATTGTCTTCTCCATCATGTCCAGCTTCACCGTCTGCGCCGTCTTCAAGATAGATTTGTCCCATATTCCAC
GCGCTGCATATCCTCTAGTTGTTCTCTCCATGAGTCTGGAAAACATTATTCGCCTCATCAATGCAGTCATTCTCA
CTCCCTTTGAGGACAGCGTCAGCAACAGGATCGGCCAAGCCTTTGGCGAGACGGCACCCACTGCTTTTGCCAGCA
CGGTACAAAACTGCTTCTTGCTGGTGTTTTTGTCTCGCCTTGTCTCGTCGGGCGTCTCAGAATTCTGCGTCTTCA
CTGCCGTGGCAATAGTATTTGACTTTTTCTACCTGTCAACTTTTTTCCTCGCCGTCTTGAGCCTTGATGTCCGAC
GCATGGAACTTGGAGACGCGCTGGCAAAGTCGGCAATGCGGCATAATCGCGACCGAGGCAACCGTGGCCAGAGCC
CCTCTTGGTGGCATCAGCTTATTCACGAAAACGTTGCCATGTCGACGCGCATTGCGGGCACCATTATTATGCTCG
GCTTTGTTCTCATTGCCCAGTGGCACTTTTTGGCCGATGAGGGCCTCTTGAGGAAGTTGTTGCGTCTCTACAGGA
TTTGTGATGCAACAATGCCCTCTGGTCTACCGCGCACCACGTTACTGGAGGATATCCATCAGGCGAGGAGCCCCA
TGTCATGGCTGCGCATGCAGGACCATGAGACGGCCCGGGAAGTCATCAATATAATCAAGCCGTCGGCCTATAGCT
ACGTGGCTCGCGTTTTCGATCCTTTGGTCCTGGTTCTCAAGGATGCGGATCGAACGCCTCACACCAATGAGCGGG
CTCTATTGCCCGCCGTCTACGATTTCATCAATCACGAGCTGACGCGCTTCGCCGTCATCGTCATAGTCATTATAG
CCTCCCTAAGGCTGCTGACCAATTATCTTCTTTGGGGAGAAGATGAGCAGAGCCTACCAGATCAACATGATGCCG
AAAAGGCTCCCATCATGTCGGTCAAGTCACTTCCTGGTCACCGCATGGATATTGTTGTCATGGCAACCTCTGCCA
ATGGCGACATTGTCACGGCTTCTATAGATTCGACTCTTCGTGTTTGGTCGATTCGTGGAATTGGTAACAGTTATC
TCATCTCCAAGGGAAACGAGACGGCAGCATCACTGTTTCCCGTTGGCACCTTGGCCATTGACGACACGTCGACGT
GGGTGGCGGTTCAAACGCGCCCCAAAGGACAGACGCTTGGCAAGGTGACGATGTGGAATCTCCGGGACCATTTCT
GGAGCCCGTCTGTCCATAGCAACAGCTGCAGGGAGAGACCAACAGCCTTCTTCTTTGATCCAAGCGCCTCACGCG
CAGAGCCTCGAGCCATCATAGTCAACCAAGACGGCACCTTGACAGAAGTGTCGGCGGGCACGTTACCCGAGCGCG
GCCCGCTTGCCGTCTTTCCTCCAGAGCTCAAGTGCGCTCGCGTGGTAGCCATCAAAGGTCCAAGCCACTCTCTTA
CCAGCGCTCAGTTACTTGAAAAGCTCAAGGCTAACCGCGCTGTGTCAATAGAGGACGACGAATTTGCCTCTCAAT
CGGTAATCATGGCTGTGTCAAAGCAGGGAGCCGTTCATCTGGCGACGCGCAGCCATGGTCATTGGAAACCTCGGC
GCTTAGCGCTTGAGGGCCTGGGGATTTCAAACACTCACAGCATCGAGGTTTTGCCTGCCATTGAGCTGTTCATTG
TGTCAGCCAAGAATTGTGTCTATTTGATAGGGGCACAGGATGGAAGCGTTTTGCACACCATTAAAACGACAGACA
AGCTTCTTAGGCCGTTGAGGTGTGCATATACATCTCACGGAGCCTCTATGCCTGGCACCATTGGACTTGCGTCAT
TTAGCCTGGCCTATGTAGAAGCTGGATCAAAGGACTGCGTTTTACAAACGATTTTGCCGCCTGAGAATTGTGACG
CCATCTACCTACGAGCGCCATCGGATGCTAGTGGCAGCGACTGGTGTACCTGGGACTCGGCAGTGGAGAAGTGGA
AGCGTGTGACAAATCCTGGCTCGTGGGACATCATTTCGGACGGCACAGCGGTTGGAATTCGATGCCGGCAGCCAA
CTATGGCGGCGCAGCAAGAGGCTGCCTCGTCTGGGCTGCGCAACCGACACGCCAAACGATCTCGCGAAACAGATG
TTTTTGGATGCTGGCAGGTGTGGACGGCGACGCCAGCTGGGCGATGTGACGCCGACGACACTCAACGGCTGGTCA
AGGAAGGCGAGGAGGACAAGCATTTGTGGATTTCTAGTCTTGGGCCCGAAGGGCGCGTGGGCATCAACTCTGTTG
GATTCGTCTTTGGCAACTTGGTGAAACTTGTTGTGATTGGTGGACCAGCAAAGCTTGCCGACAATCTGGACGAGG
TGAATACAGGCAGCAGGAGACGAAAGCCGGGCAGCGCGTCTCGCGCCAGAGTTGCAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail