Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7561
Gene name
LocationContig_898:6166..7589
Strand+
Gene length (bp)1423
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 3.2E-19 46 183
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 1.5E-20 205 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 37 344 1.0E-111
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 38 343 2.0E-104
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 12 187 1.0E-48
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 201 344 2.0E-48
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 33 189 4.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 37 344 1.0E-111
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 38 343 2.0E-104
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 12 187 1.0E-48
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 201 344 2.0E-48
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 33 189 4.0E-46
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 27 191 4.0E-41
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 27 189 2.0E-40
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 194 342 4.0E-40
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 27 192 5.0E-40
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 197 344 1.0E-39
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 44 192 1.0E-39
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 203 346 2.0E-39
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 44 189 2.0E-39
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 44 184 3.0E-39
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 203 346 6.0E-39
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 33 184 9.0E-39
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 33 184 1.0E-38
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 203 346 2.0E-38
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 33 184 3.0E-38
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 203 346 3.0E-38
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 44 184 5.0E-38
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 203 342 2.0E-37
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 203 342 2.0E-37
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 203 350 6.0E-37
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 203 350 2.0E-36
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 196 352 6.0E-35
sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana GN=At1g67280 PE=1 SV=1 30 345 3.0E-26
sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 45 345 3.0E-24
sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 45 345 3.0E-22
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 204 344 2.0E-21
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 204 344 2.0E-21
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 207 345 1.0E-20
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 204 347 2.0E-20
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 207 345 4.0E-20
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 204 344 1.0E-19
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 204 344 1.0E-19
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 204 344 1.0E-19
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 204 344 2.0E-19
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 204 344 2.0E-19
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 48 184 8.0E-19
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 200 347 1.0E-18
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 45 187 4.0E-18
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 45 187 4.0E-18
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 45 187 2.0E-17
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 45 187 2.0E-17
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 45 187 2.0E-17
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 45 192 1.0E-16
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 45 192 1.0E-16
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 41 187 2.0E-16
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 48 187 4.0E-16
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 48 187 5.0E-16
sp|P39586|YWBC_BACSU Uncharacterized protein YwbC OS=Bacillus subtilis (strain 168) GN=ywbC PE=3 SV=1 204 344 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7561
MTSLWTLQRFVHLGRIPSPSRLYSSLPSKGRQLAAMAATDLATYKFNHSMIRIKDPKESVKFYEFLGMKVVKKLE
FPEAKFDLYFLAYDSPKALSHGNDAVDREGVIELTHNYGSEKDPSFKVNNGNTEPHRGFGHTCISVDNIQAACQR
IEDAGYRFQKKLTDGRMKHIAFALDPDGYWVEIIGQKPVEETESVKETDVATYRMNHTMIRVKDAEKSLKFYQDV
LGMKLVRTVESESAGFNLYFLGYAGKQGTTTDDKTSDREGLLELTWNYGTEKDAAFAYHSGNEDPQGFGHICISV
DNIDSACQRFDNLKCRWKKRLTDGRMKNIAFLFDPDGYWIEVVQNPRYGDKHKV*
Coding >OphauG2|7561
ATGACATCCCTTTGGACATTGCAGCGCTTTGTTCACCTTGGCCGCATTCCATCACCAAGTCGTCTTTATTCCAGC
TTGCCTTCAAAAGGCAGACAACTTGCAGCCATGGCAGCCACTGACCTGGCAACGTACAAGTTTAACCACTCCATG
ATTCGAATCAAGGACCCCAAGGAATCGGTCAAATTCTACGAGTTTCTCGGCATGAAGGTTGTCAAGAAGCTCGAG
TTTCCCGAGGCCAAGTTTGACCTCTACTTCCTTGCATACGACAGCCCCAAGGCCCTCTCGCACGGAAACGACGCC
GTGGACCGCGAGGGCGTCATTGAGCTGACGCACAACTACGGCTCGGAAAAGGACCCATCCTTCAAGGTCAACAAT
GGCAACACGGAACCGCACCGGGGCTTTGGCCACACGTGCATCAGCGTAGACAATATCCAGGCCGCCTGCCAACGC
ATCGAGGATGCCGGCTACCGCTTCCAGAAGAAGCTGACGGACGGGCGTATGAAGCACATTGCCTTTGCTCTGGAC
CCAGACGGCTACTGGGTTGAAATCATTGGCCAGAAGCCGGTGGAAGAGACGGAAAGCGTCAAGGAGACTGACGTT
GCCACGTATCGCATGAACCACACCATGATACGCGTCAAGGATGCCGAAAAGTCGTTGAAATTCTACCAAGACGTG
CTTGGCATGAAACTTGTGCGAACCGTCGAGTCTGAAAGTGCCGGATTCAACCTCTACTTTCTTGGCTATGCTGGA
AAACAGGGCACTACCACTGACGACAAGACGAGCGACCGCGAGGGTCTACTAGAGCTAACCTGGAACTATGGAACG
GAAAAGGACGCCGCCTTTGCCTATCACAGCGGCAACGAGGATCCTCAAGGCTTTGGCCACATTTGCATCTCGGTG
GACAATATCGACAGTGCCTGCCAGCGGTTCGATAATCTCAAGTGCAGGTGGAAGAAGAGACTGACGGACGGACGG
ATGAAGAATATAGCCTTTTTGTTTGATCCGGACGGGTACTGGATCGAGGTTGTGCAGAATCCGCGCTACGGCGAC
AAGCATAAAGTTTAG
Transcript >OphauG2|7561
ATGACATCCCTTTGGACATTGCAGCGCTTTGTTCACCTTGGCCGCATTCCATCACCAAGTCGTCTTTATTCCAGC
TTGCCTTCAAAAGGCAGACAACTTGCAGCCATGGCAGCCACTGACCTGGCAACGTACAAGTTTAACCACTCCATG
ATTCGAATCAAGGACCCCAAGGAATCGGTCAAATTCTACGAGTTTCTCGGCATGAAGGTTGTCAAGAAGCTCGAG
TTTCCCGAGGCCAAGTTTGACCTCTACTTCCTTGCATACGACAGCCCCAAGGCCCTCTCGCACGGAAACGACGCC
GTGGACCGCGAGGGCGTCATTGAGCTGACGCACAACTACGGCTCGGAAAAGGACCCATCCTTCAAGGTCAACAAT
GGCAACACGGAACCGCACCGGGGCTTTGGCCACACGTGCATCAGCGTAGACAATATCCAGGCCGCCTGCCAACGC
ATCGAGGATGCCGGCTACCGCTTCCAGAAGAAGCTGACGGACGGGCGTATGAAGCACATTGCCTTTGCTCTGGAC
CCAGACGGCTACTGGGTTGAAATCATTGGCCAGAAGCCGGTGGAAGAGACGGAAAGCGTCAAGGAGACTGACGTT
GCCACGTATCGCATGAACCACACCATGATACGCGTCAAGGATGCCGAAAAGTCGTTGAAATTCTACCAAGACGTG
CTTGGCATGAAACTTGTGCGAACCGTCGAGTCTGAAAGTGCCGGATTCAACCTCTACTTTCTTGGCTATGCTGGA
AAACAGGGCACTACCACTGACGACAAGACGAGCGACCGCGAGGGTCTACTAGAGCTAACCTGGAACTATGGAACG
GAAAAGGACGCCGCCTTTGCCTATCACAGCGGCAACGAGGATCCTCAAGGCTTTGGCCACATTTGCATCTCGGTG
GACAATATCGACAGTGCCTGCCAGCGGTTCGATAATCTCAAGTGCAGGTGGAAGAAGAGACTGACGGACGGACGG
ATGAAGAATATAGCCTTTTTGTTTGATCCGGACGGGTACTGGATCGAGGTTGTGCAGAATCCGCGCTACGGCGAC
AAGCATAAAGTTTAG
Gene >OphauG2|7561
ATGACATCCCTTTGGACATTGCAGCGCTTTGTTCACCTTGGCCGCATTCCATCACCAAGTCGTCTTTATTCCAGC
TTGCCTTGTATGATGAGTCGCTCTCGGTGGGAGTGGTGAATTAGCATTTTGGCTGATTTGTGTACAGCAAAAGGC
AGACAACTTGCAGCCATGGCAGCCACTGACCTGGCAACGTACAAGTTTAACCACTCCATGTAGGACATTTTCCGC
CTTGGTTCGACGTCTTGGACTAACTTGGGCAGGATTCGAATCAAGGACCCCAAGGAATCGGGTAGGAAGGTCTTG
TTCCCCCCCCCAGGCCAAGTCTCAGTCAGACTTACACTAGTCGCCAGTCAAATTCTACGAGTTTCTCGGCATGAA
GGTTGTCAAGAAGCTCGAGTTTCCCGAGGCCAAGTTTGACCTCTACTTCCTTGCATACGACAGCCCCAAGGCCCT
CTCGCACGGAAACGACGCCGTGGACCGCGAGGGCGTCATTGAGCTGACGCACAACTACGGCTCGGAAAAGGACCC
ATCCTTCAAGGTCAACAATGGCAACACGGAACCGCACCGGGGCTTTGGCCACACGTGCATCAGCGTAGACAATAT
CCAGGCCGCCTGCCAACGCATCGAGGATGCCGGCTACCGCTTCCAGAAGAAGCTGACGGACGGGCGTATGAAGCA
CATTGCCTTTGCTCTGGACCCAGACGGCTACTGGGTTGAAATCATTGGCCAGAAGCCGGTGGAAGAGACGGAAAG
CGTCAAGGAGACTGACGTTGCCACGTATCGCATGGTATCCAGCCTCTGGCCCAAAAACACCCTCTCTGCGTAGCG
GCTAAGAGTCCACAGAACCACACCATGATACGCGTCAAGGATGCCGAAAAGTCGTTGAAATTCTACCAAGACGTG
CTTGGCATGAAACTTGTGCGAACCGTCGAGTCTGAAAGTGCCGGATTCAACCTCTACTTTCTTGGCTATGCTGGA
AAACAGGGCACTACCACTGACGACAAGACGAGCGACCGCGAGGGTCTACTAGAGCTAACCTGGAACTATGGAACG
GAAAAGGACGCCGCCTTTGCCTATCACAGCGGCAACGAGGATCCTCAAGGCTTTGGCCACATTTGTAAGTGTGGC
TTTTATAAAAGAAGCGACTCTGGAAATGAATATATATATATTTTTTTGAGCACACTGCTGCAGTTTGATGCGAGG
GAGGGGGACCAAGGTTCATTGCTAATGCAGCCAATTTTTTTTTTTAGGCATCTCGGTGGACAATATCGACAGTGC
CTGCCAGCGGTTCGATAATCTCAAGTGCAGGTGGAAGAAGAGACTGACGGACGGACGGATGAAGAATATAGCCTT
TTTGTTTGATCCGGACGGGTACTGGATCGAGGTTGTGCAGAATCCGCGCTACGGCGACAAGCATAAAGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail