Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7548
Gene name
LocationContig_893:7048..7639
Strand-
Gene length (bp)591
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09044 Kp4 Kp4 8.3E-30 5 122

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q90121|KP4T_UMV4 KP4 killer toxin OS=Ustilago maydis P4 virus GN=M2A PE=1 SV=1 3 122 9.0E-15

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999717

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7548 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1409
Ophiocordyceps australis map64 (Brazil) OphauB2|1410
Ophiocordyceps australis map64 (Brazil) OphauB2|1411
Ophiocordyceps subramaniannii Hirsu2|1492
Ophiocordyceps subramaniannii Hirsu2|6695
Ophiocordyceps subramaniannii Hirsu2|6696
Ophiocordyceps subramaniannii Hirsu2|6697

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7548
MASFALIASFIATAAALGINCRGSGACNLNDASLSDVLTQVRQIQARGLGSHHYATGVQLACAQGKYASICAFYQ
SGASGTADFAAELLQGLINHKCTQCGSNPTQPGNDVSKGQLTVNIVSQPCCHGTCQCPI*
Coding >OphauG2|7548
ATGGCGTCTTTTGCCTTGATTGCCAGCTTCATTGCCACCGCGGCGGCGCTTGGCATCAATTGCCGCGGCTCAGGC
GCTTGCAATCTCAACGATGCTAGTCTCTCAGATGTCTTGACCCAAGTCCGGCAGATACAGGCTCGAGGCCTGGGC
TCGCATCATTATGCCACTGGAGTTCAATTGGCTTGCGCCCAAGGCAAATATGCTTCCATTTGTGCCTTTTATCAG
AGCGGGGCCAGTGGCACGGCAGATTTCGCTGCCGAGCTTCTCCAGGGCCTGATTAACCACAAATGCACACAGTGT
GGCAGCAATCCAACGCAGCCTGGCAACGATGTCAGCAAGGGCCAGTTGACGGTGAATATTGTGAGCCAGCCTTGC
TGCCATGGCACCTGCCAGTGTCCCATCTAG
Transcript >OphauG2|7548
ATGGCGTCTTTTGCCTTGATTGCCAGCTTCATTGCCACCGCGGCGGCGCTTGGCATCAATTGCCGCGGCTCAGGC
GCTTGCAATCTCAACGATGCTAGTCTCTCAGATGTCTTGACCCAAGTCCGGCAGATACAGGCTCGAGGCCTGGGC
TCGCATCATTATGCCACTGGAGTTCAATTGGCTTGCGCCCAAGGCAAATATGCTTCCATTTGTGCCTTTTATCAG
AGCGGGGCCAGTGGCACGGCAGATTTCGCTGCCGAGCTTCTCCAGGGCCTGATTAACCACAAATGCACACAGTGT
GGCAGCAATCCAACGCAGCCTGGCAACGATGTCAGCAAGGGCCAGTTGACGGTGAATATTGTGAGCCAGCCTTGC
TGCCATGGCACCTGCCAGTGTCCCATCTAG
Gene >OphauG2|7548
ATGGCGTCTTTTGCCTTGATTGCCAGCTTCATTGCCACCGCGGCGGCGCTTGGCATCAATTGCCGCGGCTCAGGC
GCTTGCAATCTCAACGATGCTAGTCTCTCAGATGTCTTGACCCAAGTCCGGCAGATACAGGCTCGAGGCCTGGGC
TCGCATCATTATGCCACTGGAGGTAAGGCGACAACAAGAGATGCTCGAGGCGTGTGTCTGCTTTTCTTTTCTTTT
CTTTTCTTTTTTCTATATTTTTTCTTTTTTTTTTCTGTATTTTGTGTTTTTTTCTTTGTGTGTTTTTTTTTTCCA
TGTTTTGTTTTTTTCTACATCTTTAAACATTCTTTACTGACTCGCTTGCATCGTCTAGTTCAATTGGCTTGCGCC
CAAGGCAAATATGCTTCCATTTGTGCCTTTTATCAGAGCGGGGCCAGTGGCACGGCAGATTTCGCTGCCGAGCTT
CTCCAGGGCCTGATTAACCACAAATGCACACAGTGTGGCAGCAATCCAACGCAGCCTGGCAACGATGTCAGCAAG
GGCCAGTTGACGGTGAATATTGTGAGCCAGCCTTGCTGCCATGGCACCTGCCAGTGTCCCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail