Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7539
Gene name
LocationContig_891:130..2416
Strand-
Gene length (bp)2286
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 8.8E-45 216 489
PF05199 GMC_oxred_C GMC oxidoreductase 6.0E-30 569 727
PF00890 FAD_binding_2 FAD binding domain 3.1E-07 216 253
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 9.7E-07 216 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5WWZ9|FAO2_LOTJA Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus GN=FAO2 PE=2 SV=1 209 737 1.0E-90
sp|Q9LW56|FAO3_ARATH Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana GN=FAO3 PE=1 SV=1 233 740 3.0E-77
sp|B5WWZ8|FAO1_LOTJA Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus GN=FAO1 PE=1 SV=1 157 737 1.0E-74
sp|Q94BP3|FAO4B_ARATH Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana GN=FAO4B PE=2 SV=2 110 737 5.0E-73
sp|O65709|FAO4A_ARATH Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana GN=FAO4A PE=3 SV=2 233 737 8.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5WWZ9|FAO2_LOTJA Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus GN=FAO2 PE=2 SV=1 209 737 1.0E-90
sp|Q9LW56|FAO3_ARATH Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana GN=FAO3 PE=1 SV=1 233 740 3.0E-77
sp|B5WWZ8|FAO1_LOTJA Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus GN=FAO1 PE=1 SV=1 157 737 1.0E-74
sp|Q94BP3|FAO4B_ARATH Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana GN=FAO4B PE=2 SV=2 110 737 5.0E-73
sp|O65709|FAO4A_ARATH Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana GN=FAO4A PE=3 SV=2 233 737 8.0E-65
sp|Q9ZWB9|FAO1_ARATH Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana GN=FAO1 PE=3 SV=2 233 730 9.0E-65
sp|P9WMV7|Y492_MYCTU Uncharacterized GMC-type oxidoreductase Rv0492c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0492c PE=1 SV=1 216 726 6.0E-34
sp|P9WMV6|Y492_MYCTO Uncharacterized GMC-type oxidoreductase MT0511/MT0512 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0511/MT0512 PE=3 SV=1 216 726 6.0E-34
sp|P55582|Y4NJ_RHISN Uncharacterized GMC-type oxidoreductase y4nJ OS=Rhizobium sp. (strain NGR234) GN=NGR_a02320 PE=3 SV=1 212 734 4.0E-21
sp|Q7X2H8|CHOX_ARTGO Choline oxidase OS=Arthrobacter globiformis GN=codA PE=1 SV=1 395 740 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7539
MHAPLQHQPVAVPMPSPPSNDFMSEQQWDTLFALIDGCLPSISTDAPDHDRLGLAGEELDGMVQEISRRCKDGPS
KDQVKAFLQARPSQDSKLRAECIRTLSTMPQRTQLATALRLLSTRHGSLLLTGSWTPITAQPVTVREAIVRSWCD
SWLPSLRMLAKGVVAAAQKANSMSSPYFAQLSGYNDVPRNWKAGEGYKFDFIQLAPGSQVHEMMTDVVVIGSGCG
GAVAAKNLAEAGHQVLVVDKGYYFPTSHLPMAQDAACHYLYDHCGLWLTDDASTNILSGSSWGGGGTINWSVCFR
LQDFVRREWAAQGLPLFESAAFDECMDRVWDFVGASTSGIRHNHRNQVMLDGCRKLGWKGRTVEQNTANKEHYCG
QCHLGCGSAEKRGPTVAWLPAAAEAGADFLEGFNAERIIFADDGVTATGVEGVWTARDDSGQVHRPASCRTQRRV
RIRAKRVVLAAGSIRSPVMLIKSGVDNPSVGRNLHLHPCNIVTATYDDETRPWEGGIITSYSGEFENLDCEGHGV
KLEPIVMVPYTLYATQPWRGGLDAKQLLLRYANLASFIVLTRDRDSGRVYMDRKTGEPRIDYTPSDFDRDHTLEG
VQAMAKICYVTGAKEIRAGLPRLEPWVPLDNGERQRRHVEGKDPEFTDPAFGAWLQRLRQVDNRPPETTFASAHQ
MGSCRMSSSPETGVVDERGAVWGTRNLFVADASVFPSASGVNPMLTVMSLADWISRCVIKDLAAGGN*
Coding >OphauG2|7539
ATGCATGCACCGCTCCAGCACCAGCCCGTGGCAGTGCCCATGCCCTCGCCTCCCAGCAACGACTTCATGTCGGAG
CAGCAGTGGGACACGCTGTTCGCCCTCATCGACGGCTGCCTGCCGTCCATCTCGACGGACGCGCCCGACCACGAC
AGGCTGGGGCTGGCAGGCGAGGAGCTGGATGGCATGGTACAGGAGATTTCAAGGCGGTGCAAGGACGGGCCCAGC
AAGGACCAGGTCAAGGCCTTTCTCCAGGCCAGGCCGTCTCAGGACAGCAAGCTCCGGGCGGAGTGCATCCGGACC
TTGTCGACGATGCCACAGCGCACGCAGCTGGCCACGGCGCTGCGGCTCCTGAGCACGCGACATGGCAGCCTGCTG
CTGACGGGCTCGTGGACGCCCATCACGGCGCAGCCGGTGACTGTGCGCGAGGCGATTGTCAGGTCGTGGTGCGAC
TCGTGGCTGCCCAGCCTGCGCATGCTGGCCAAGGGCGTGGTGGCGGCGGCGCAAAAGGCCAACTCGATGTCGAGC
CCGTACTTTGCGCAGCTGTCGGGCTACAACGACGTGCCGCGCAACTGGAAGGCGGGCGAGGGCTACAAGTTTGAC
TTTATCCAGCTGGCTCCGGGCAGCCAGGTGCACGAGATGATGACGGACGTGGTGGTGATTGGGTCGGGCTGTGGC
GGCGCCGTGGCGGCAAAGAACCTGGCCGAGGCTGGCCACCAGGTGCTGGTCGTCGACAAAGGCTACTACTTCCCC
ACGTCGCATCTGCCCATGGCCCAGGACGCGGCCTGCCACTATCTGTACGATCACTGCGGGCTCTGGCTGACGGAC
GACGCGAGCACCAACATCCTCAGCGGCAGCAGCTGGGGCGGCGGCGGCACCATCAACTGGAGCGTCTGCTTCCGG
CTGCAGGACTTTGTGCGTCGCGAGTGGGCGGCGCAGGGCCTGCCGCTGTTTGAGTCGGCCGCCTTTGACGAGTGC
ATGGACCGCGTCTGGGACTTTGTGGGCGCCAGCACCAGCGGCATCCGCCACAACCACCGCAACCAAGTCATGCTG
GACGGCTGCCGCAAGCTGGGCTGGAAGGGCCGCACGGTGGAGCAGAACACGGCCAACAAGGAGCACTACTGCGGC
CAGTGCCACCTGGGCTGTGGCTCGGCCGAGAAGCGCGGCCCAACCGTGGCCTGGCTGCCGGCGGCTGCCGAGGCT
GGCGCCGACTTTCTCGAGGGCTTCAACGCCGAGCGCATCATCTTTGCCGACGATGGCGTCACGGCCACGGGCGTC
GAGGGCGTGTGGACGGCGCGCGACGACAGCGGCCAGGTGCACAGGCCCGCCAGCTGCCGCACGCAGCGCCGCGTG
CGCATCAGGGCCAAGAGGGTGGTGCTGGCCGCAGGCTCGATCCGCAGCCCCGTCATGCTCATCAAGAGCGGCGTC
GACAACCCCAGCGTGGGCAGAAACCTGCACCTGCACCCGTGCAACATTGTCACGGCCACGTACGACGACGAGACG
CGGCCATGGGAGGGCGGCATCATCACGAGCTACAGCGGCGAGTTTGAAAACCTCGACTGCGAGGGCCACGGCGTC
AAGCTGGAGCCCATTGTCATGGTGCCCTACACCCTCTACGCCACCCAGCCCTGGCGCGGCGGGCTCGATGCCAAA
CAGCTCTTGCTGCGCTACGCCAACCTGGCCAGCTTCATTGTGCTGACGCGCGACCGCGACTCGGGCCGCGTCTAC
ATGGACCGCAAGACGGGCGAGCCGCGCATCGACTACACCCCCTCCGACTTTGACCGCGACCACACGCTCGAGGGC
GTGCAGGCCATGGCCAAGATATGCTACGTCACAGGCGCCAAGGAGATTCGGGCTGGCCTGCCGCGCCTGGAGCCG
TGGGTTCCGCTCGACAATGGCGAGCGGCAGAGGCGGCACGTTGAGGGCAAAGACCCCGAGTTTACCGACCCGGCC
TTTGGGGCCTGGCTGCAGCGCCTGCGCCAAGTCGACAATCGCCCGCCTGAAACCACCTTTGCATCTGCCCACCAA
ATGGGCAGCTGTCGCATGAGCTCGAGTCCAGAGACGGGCGTGGTTGATGAGCGAGGCGCCGTCTGGGGCACGCGC
AATCTGTTTGTCGCTGATGCTAGTGTTTTCCCCAGCGCTAGTGGCGTCAATCCAATGTTGACCGTTATGTCTCTG
GCCGACTGGATTTCGCGGTGCGTCATCAAGGACCTTGCCGCCGGCGGCAACTAG
Transcript >OphauG2|7539
ATGCATGCACCGCTCCAGCACCAGCCCGTGGCAGTGCCCATGCCCTCGCCTCCCAGCAACGACTTCATGTCGGAG
CAGCAGTGGGACACGCTGTTCGCCCTCATCGACGGCTGCCTGCCGTCCATCTCGACGGACGCGCCCGACCACGAC
AGGCTGGGGCTGGCAGGCGAGGAGCTGGATGGCATGGTACAGGAGATTTCAAGGCGGTGCAAGGACGGGCCCAGC
AAGGACCAGGTCAAGGCCTTTCTCCAGGCCAGGCCGTCTCAGGACAGCAAGCTCCGGGCGGAGTGCATCCGGACC
TTGTCGACGATGCCACAGCGCACGCAGCTGGCCACGGCGCTGCGGCTCCTGAGCACGCGACATGGCAGCCTGCTG
CTGACGGGCTCGTGGACGCCCATCACGGCGCAGCCGGTGACTGTGCGCGAGGCGATTGTCAGGTCGTGGTGCGAC
TCGTGGCTGCCCAGCCTGCGCATGCTGGCCAAGGGCGTGGTGGCGGCGGCGCAAAAGGCCAACTCGATGTCGAGC
CCGTACTTTGCGCAGCTGTCGGGCTACAACGACGTGCCGCGCAACTGGAAGGCGGGCGAGGGCTACAAGTTTGAC
TTTATCCAGCTGGCTCCGGGCAGCCAGGTGCACGAGATGATGACGGACGTGGTGGTGATTGGGTCGGGCTGTGGC
GGCGCCGTGGCGGCAAAGAACCTGGCCGAGGCTGGCCACCAGGTGCTGGTCGTCGACAAAGGCTACTACTTCCCC
ACGTCGCATCTGCCCATGGCCCAGGACGCGGCCTGCCACTATCTGTACGATCACTGCGGGCTCTGGCTGACGGAC
GACGCGAGCACCAACATCCTCAGCGGCAGCAGCTGGGGCGGCGGCGGCACCATCAACTGGAGCGTCTGCTTCCGG
CTGCAGGACTTTGTGCGTCGCGAGTGGGCGGCGCAGGGCCTGCCGCTGTTTGAGTCGGCCGCCTTTGACGAGTGC
ATGGACCGCGTCTGGGACTTTGTGGGCGCCAGCACCAGCGGCATCCGCCACAACCACCGCAACCAAGTCATGCTG
GACGGCTGCCGCAAGCTGGGCTGGAAGGGCCGCACGGTGGAGCAGAACACGGCCAACAAGGAGCACTACTGCGGC
CAGTGCCACCTGGGCTGTGGCTCGGCCGAGAAGCGCGGCCCAACCGTGGCCTGGCTGCCGGCGGCTGCCGAGGCT
GGCGCCGACTTTCTCGAGGGCTTCAACGCCGAGCGCATCATCTTTGCCGACGATGGCGTCACGGCCACGGGCGTC
GAGGGCGTGTGGACGGCGCGCGACGACAGCGGCCAGGTGCACAGGCCCGCCAGCTGCCGCACGCAGCGCCGCGTG
CGCATCAGGGCCAAGAGGGTGGTGCTGGCCGCAGGCTCGATCCGCAGCCCCGTCATGCTCATCAAGAGCGGCGTC
GACAACCCCAGCGTGGGCAGAAACCTGCACCTGCACCCGTGCAACATTGTCACGGCCACGTACGACGACGAGACG
CGGCCATGGGAGGGCGGCATCATCACGAGCTACAGCGGCGAGTTTGAAAACCTCGACTGCGAGGGCCACGGCGTC
AAGCTGGAGCCCATTGTCATGGTGCCCTACACCCTCTACGCCACCCAGCCCTGGCGCGGCGGGCTCGATGCCAAA
CAGCTCTTGCTGCGCTACGCCAACCTGGCCAGCTTCATTGTGCTGACGCGCGACCGCGACTCGGGCCGCGTCTAC
ATGGACCGCAAGACGGGCGAGCCGCGCATCGACTACACCCCCTCCGACTTTGACCGCGACCACACGCTCGAGGGC
GTGCAGGCCATGGCCAAGATATGCTACGTCACAGGCGCCAAGGAGATTCGGGCTGGCCTGCCGCGCCTGGAGCCG
TGGGTTCCGCTCGACAATGGCGAGCGGCAGAGGCGGCACGTTGAGGGCAAAGACCCCGAGTTTACCGACCCGGCC
TTTGGGGCCTGGCTGCAGCGCCTGCGCCAAGTCGACAATCGCCCGCCTGAAACCACCTTTGCATCTGCCCACCAA
ATGGGCAGCTGTCGCATGAGCTCGAGTCCAGAGACGGGCGTGGTTGATGAGCGAGGCGCCGTCTGGGGCACGCGC
AATCTGTTTGTCGCTGATGCTAGTGTTTTCCCCAGCGCTAGTGGCGTCAATCCAATGTTGACCGTTATGTCTCTG
GCCGACTGGATTTCGCGGTGCGTCATCAAGGACCTTGCCGCCGGCGGCAACTAG
Gene >OphauG2|7539
ATGCATGCACCGCTCCAGCACCAGCCCGTGGCAGTGCCCATGCCCTCGCCTCCCAGCAACGACTTCATGTCGGAG
CAGCAGTGGGACACGCTGTTCGCCCTCATCGACGGCTGCCTGCCGTCCATCTCGACGGACGCGCCCGACCACGAC
AGGCTGGGGCTGGCAGGCGAGGAGCTGGATGGCATGGTACAGGAGATTTCAAGGCGGTGCAAGGACGGGCCCAGC
AAGGACCAGGTCAAGGCCTTTCTCCAGGCCAGGCCGTCTCAGGACAGCAAGCTCCGGGCGGAGTGCATCCGGACC
TTGTCGACGATGCCACAGCGCACGCAGCTGGCCACGGCGCTGCGGCTCCTGAGCACGCGACATGGCAGCCTGCTG
CTGACGGGCTCGTGGACGCCCATCACGGCGCAGCCGGTGACTGTGCGCGAGGCGATTGTCAGGTCGTGGTGCGAC
TCGTGGCTGCCCAGCCTGCGCATGCTGGCCAAGGGCGTGGTGGCGGCGGCGCAAAAGGCCAACTCGATGTCGAGC
CCGTACTTTGCGCAGCTGTCGGGCTACAACGACGTGCCGCGCAACTGGAAGGCGGGCGAGGGCTACAAGTTTGAC
TTTATCCAGCTGGCTCCGGGCAGCCAGGTGCACGAGATGATGACGGACGTGGTGGTGATTGGGTCGGGCTGTGGC
GGCGCCGTGGCGGCAAAGAACCTGGCCGAGGCTGGCCACCAGGTGCTGGTCGTCGACAAAGGCTACTACTTCCCC
ACGTCGCATCTGCCCATGGCCCAGGACGCGGCCTGCCACTATCTGTACGATCACTGCGGGCTCTGGCTGACGGAC
GACGCGAGCACCAACATCCTCAGCGGCAGCAGCTGGGGCGGCGGCGGCACCATCAACTGGAGCGTCTGCTTCCGG
CTGCAGGACTTTGTGCGTCGCGAGTGGGCGGCGCAGGGCCTGCCGCTGTTTGAGTCGGCCGCCTTTGACGAGTGC
ATGGACCGCGTCTGGGACTTTGTGGGCGCCAGCACCAGCGGCATCCGCCACAACCACCGCAACCAAGTCATGCTG
GACGGCTGCCGCAAGCTGGGCTGGAAGGGCCGCACGGTGGAGCAGAACACGGCCAACAAGGAGCACTACTGCGGC
CAGTGCCACCTGGGCTGTGGCTCGGCCGAGAAGCGCGGCCCAACCGTGGCCTGGCTGCCGGCGGCTGCCGAGGCT
GGCGCCGACTTTCTCGAGGGCTTCAACGCCGAGCGCATCATCTTTGCCGACGATGGCGTCACGGCCACGGGCGTC
GAGGGCGTGTGGACGGCGCGCGACGACAGCGGCCAGGTGCACAGGCCCGCCAGCTGCCGCACGCAGCGCCGCGTG
CGCATCAGGGCCAAGAGGGTGGTGCTGGCCGCAGGCTCGATCCGCAGCCCCGTCATGCTCATCAAGAGCGGCGTC
GACAACCCCAGCGTGGGCAGAAACCTGCACCTGCACCCGTGCAACATTGTCACGGCCACGTACGACGACGAGACG
CGGCCATGGGAGGGCGGCATCATCACGAGCTACAGCGGCGAGTTTGAAAACCTCGACTGCGAGGGCCACGGCGTC
AAGCTGGAGCCCATTGTCATGGTGGTGAGAAGAGGTGCTCCCCAACCGAGAGCTGCTGGCTAACCACGTCGCTGC
TGATAGCCCTACACCCTCTACGCCACCCAGCCCTGGCGCGGCGGGCTCGATGCCAAACAGCTCTTGCTGCGCTAC
GCCAACCTGGCCAGCTTCATTGTGCTGACGCGCGACCGCGACTCGGGCCGCGTCTACATGGACCGCAAGACGGGC
GAGCCGCGCATCGACTACACCCCCTCCGACTTTGACCGCGACCACACGCTCGAGGGCGTGCAGGCCATGGCCAAG
ATATGCTACGTCACAGGCGCCAAGGAGATTCGGGCTGGCCTGCCGCGCCTGGAGCCGTGGGTTCCGCTCGACAAT
GGCGAGCGGCAGAGGCGGCACGTTGAGGGCAAAGACCCCGAGTTTACCGACCCGGCCTTTGGGGCCTGGCTGCAG
CGCCTGCGCCAAGTCGACAATCGCCCGCCTGAAACCACCTTTGCATCTGCCCACCAAATGGGCAGCTGTCGCATG
AGCTCGAGTCCAGAGACGGGCGTGGTTGATGAGCGAGGCGCCGTCTGGGGCACGCGCAATCTGTTTGTCGCTGAT
GCTAGTGTTTTCCCCAGCGCTAGTGGCGTCAATCCAATGTTGACCGTTATGTCTCTGGCCGACTGGATTTCGCGG
TGCGTCATCAAGGACCTTGCCGCCGGCGGCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail