Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7535
Gene name
LocationContig_89:29646..31850
Strand-
Gene length (bp)2204
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09825 BPL_N Biotin-protein ligase, N terminal 1.2E-111 7 287
PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family 8.9E-19 394 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 6 658 2.0E-117
sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 6 657 3.0E-111
sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1 7 657 2.0E-39
sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 337 657 3.0E-38
sp|Q9SL92|HCS1_ARATH Biotin--protein ligase 1, chloroplastic OS=Arabidopsis thaliana GN=HCS1 PE=1 SV=2 386 658 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 6 658 2.0E-117
sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 6 657 3.0E-111
sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1 7 657 2.0E-39
sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 337 657 3.0E-38
sp|Q9SL92|HCS1_ARATH Biotin--protein ligase 1, chloroplastic OS=Arabidopsis thaliana GN=HCS1 PE=1 SV=2 386 658 2.0E-37
sp|F4I4W2|HCS2_ARATH Biotin--protein ligase 2 OS=Arabidopsis thaliana GN=HCS2 PE=2 SV=1 386 658 8.0E-37
sp|Q9PL03|Y305_CHLMU Uncharacterized protein TC_0305 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0305 PE=3 SV=1 8 227 5.0E-26
sp|O84038|Y035_CHLTR Uncharacterized protein CT_035 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_035 PE=3 SV=1 8 249 8.0E-23
sp|Q9Z953|Y128_CHLPN Uncharacterized protein CPn_0128/CP_0643/CPj0128/CpB0130 OS=Chlamydia pneumoniae GN=CPn_0128 PE=3 SV=1 5 262 1.0E-21
sp|P06709|BIRA_ECOLI Bifunctional ligase/repressor BirA OS=Escherichia coli (strain K12) GN=birA PE=1 SV=1 397 582 2.0E-07
sp|P46363|BIRA_HAEIN Bifunctional ligase/repressor BirA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=birA PE=3 SV=1 394 624 5.0E-07
sp|Q9JWI7|BICOA_NEIMA Bifunctional enzyme BirA/CoaX OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=birA/coaX PE=3 SV=1 426 582 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0036211 protein modification process Yes
GO:0044238 primary metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7535
MSSRRLNVLVYTGTGTSVESVRQCVYSLQCLVSDTYAVAPVNETTLLKEPWAATCALLVIPGGADLGYCRVLNGA
GNRLISDYVRRGGAYLGFCAGAYYASGRCEFEVGNGELEVIGSRELALFPGICRGAAFSGFEYGSERGARACHVA
VHGGVFEPQQAVPDSFACYFNGGGVFVDAASVTSRKVQVLASYRDDIHVDGGDGKAAMVLCHVGEGKALLTGPHP
EFAAANLSPQPSLPGYDRLIQELEANDKARVSFLRACLCKLGLEVGLDDAPVATLSSIYLCSTDPPRVARLVDAW
HLIADNSNGQLLIRGESDTFLIELQQPCAGRMEPDRPQGIIDYTSITKHIIPHQETLPPPSLTPHWNHELYFSSL
ERFHAEKNNVNRWGSLFMYGEVVTSTNSLLEKNPAFMSTLPTGFVFSASTQLSARGRGNNAWVAPRGALMFSAII
SHPARLAASRPIVFTQYVAAIAIVEAIQSLGAGYEKLPVKLKWPNDIYALDPASASQRYVKVGGILSQCCYFDGS
YQIVLGIGINASNPRPTTSLSSLAPPHAAPLQLEVLLARLLASLEAAYSQFLREGFSIDLEHRYYRHWLHTGQLV
QLDTQGGERARVLGITSDWGMLRVEQTDQDGRGTGKIWTLQSDENSFDFWKGLVRRKL*
Coding >OphauG2|7535
ATGTCCAGCAGACGGCTCAACGTCCTTGTATACACGGGCACCGGCACCAGCGTCGAGTCGGTTCGGCAGTGCGTC
TACTCGCTGCAATGCCTAGTCTCCGACACATACGCCGTTGCGCCAGTCAACGAGACAACGCTTCTCAAGGAGCCC
TGGGCAGCGACGTGTGCTCTTCTTGTCATCCCGGGCGGCGCCGACCTGGGCTACTGCCGCGTCCTCAACGGGGCT
GGAAACCGGCTCATCAGCGACTACGTCCGGCGAGGCGGGGCCTATCTCGGCTTCTGTGCTGGCGCCTACTATGCA
AGTGGCCGCTGCGAGTTTGAGGTGGGCAATGGCGAGCTCGAGGTTATCGGAAGCCGCGAGCTGGCCCTGTTCCCC
GGCATCTGTCGCGGCGCTGCCTTTTCAGGCTTCGAGTACGGCAGCGAGAGGGGAGCCCGGGCCTGTCATGTCGCA
GTCCATGGTGGCGTCTTTGAGCCCCAGCAGGCCGTGCCAGACAGCTTTGCCTGCTACTTCAACGGCGGCGGCGTC
TTTGTCGATGCCGCCAGCGTCACAAGCCGCAAGGTGCAAGTCTTGGCCTCGTATCGCGACGACATTCATGTGGAT
GGTGGTGACGGCAAGGCTGCCATGGTTCTGTGCCACGTGGGCGAGGGCAAGGCGCTCCTCACAGGGCCGCATCCC
GAATTTGCTGCTGCCAATCTCTCGCCTCAGCCCAGCCTGCCCGGATACGACCGGCTCATTCAGGAGCTCGAGGCC
AACGATAAAGCGCGCGTCAGCTTCCTCAGGGCCTGCCTGTGCAAGCTGGGGCTTGAGGTTGGTCTAGACGACGCT
CCAGTGGCGACGCTGTCGAGCATTTACCTTTGCTCCACCGACCCTCCCAGAGTCGCGCGCCTTGTCGACGCCTGG
CACCTGATTGCAGACAACAGCAACGGCCAGCTTTTGATCCGCGGCGAATCAGACACATTTCTCATTGAGTTGCAA
CAGCCATGTGCTGGCCGCATGGAGCCCGACAGGCCGCAAGGAATCATCGACTATACGTCTATTACCAAGCACATT
ATCCCTCACCAAGAGACACTGCCACCACCCAGTCTGACGCCGCACTGGAACCACGAGCTCTACTTCTCAAGCCTG
GAGCGCTTCCACGCAGAAAAAAACAATGTCAATCGCTGGGGCTCCTTGTTCATGTATGGAGAAGTTGTCACAAGC
ACCAACTCGCTTCTAGAAAAAAACCCAGCCTTCATGTCTACATTGCCCACGGGATTCGTCTTTTCCGCATCCACT
CAACTTTCTGCGCGGGGCCGTGGAAACAACGCTTGGGTCGCTCCTCGCGGTGCCCTCATGTTTTCCGCCATCATC
AGTCATCCAGCCCGACTCGCTGCGTCTCGGCCCATCGTCTTTACTCAATATGTGGCTGCCATTGCCATTGTCGAG
GCTATTCAGTCTCTGGGTGCAGGATACGAAAAGCTGCCAGTCAAGTTAAAATGGCCCAACGATATTTATGCTCTC
GATCCCGCTTCTGCCTCGCAACGCTATGTCAAGGTTGGCGGTATTCTTAGCCAGTGCTGCTACTTTGATGGTTCC
TATCAGATTGTCCTGGGCATAGGCATAAATGCAAGCAACCCACGCCCGACTACCTCTCTTTCCAGCCTCGCTCCG
CCTCATGCAGCCCCTCTGCAACTTGAAGTCCTCCTTGCGCGTCTGCTTGCTAGTCTTGAGGCTGCCTACTCGCAG
TTTCTGCGCGAAGGCTTCTCGATCGATCTTGAACATCGCTACTATCGTCATTGGCTGCACACCGGACAACTGGTG
CAACTCGATACCCAAGGCGGCGAGCGGGCGCGTGTACTTGGCATCACAAGCGACTGGGGAATGCTGCGCGTCGAA
CAGACTGACCAAGACGGCAGGGGCACAGGCAAGATTTGGACCCTGCAGAGCGATGAAAACAGCTTCGACTTCTGG
AAAGGTCTTGTACGCAGAAAGCTGTAG
Transcript >OphauG2|7535
ATGTCCAGCAGACGGCTCAACGTCCTTGTATACACGGGCACCGGCACCAGCGTCGAGTCGGTTCGGCAGTGCGTC
TACTCGCTGCAATGCCTAGTCTCCGACACATACGCCGTTGCGCCAGTCAACGAGACAACGCTTCTCAAGGAGCCC
TGGGCAGCGACGTGTGCTCTTCTTGTCATCCCGGGCGGCGCCGACCTGGGCTACTGCCGCGTCCTCAACGGGGCT
GGAAACCGGCTCATCAGCGACTACGTCCGGCGAGGCGGGGCCTATCTCGGCTTCTGTGCTGGCGCCTACTATGCA
AGTGGCCGCTGCGAGTTTGAGGTGGGCAATGGCGAGCTCGAGGTTATCGGAAGCCGCGAGCTGGCCCTGTTCCCC
GGCATCTGTCGCGGCGCTGCCTTTTCAGGCTTCGAGTACGGCAGCGAGAGGGGAGCCCGGGCCTGTCATGTCGCA
GTCCATGGTGGCGTCTTTGAGCCCCAGCAGGCCGTGCCAGACAGCTTTGCCTGCTACTTCAACGGCGGCGGCGTC
TTTGTCGATGCCGCCAGCGTCACAAGCCGCAAGGTGCAAGTCTTGGCCTCGTATCGCGACGACATTCATGTGGAT
GGTGGTGACGGCAAGGCTGCCATGGTTCTGTGCCACGTGGGCGAGGGCAAGGCGCTCCTCACAGGGCCGCATCCC
GAATTTGCTGCTGCCAATCTCTCGCCTCAGCCCAGCCTGCCCGGATACGACCGGCTCATTCAGGAGCTCGAGGCC
AACGATAAAGCGCGCGTCAGCTTCCTCAGGGCCTGCCTGTGCAAGCTGGGGCTTGAGGTTGGTCTAGACGACGCT
CCAGTGGCGACGCTGTCGAGCATTTACCTTTGCTCCACCGACCCTCCCAGAGTCGCGCGCCTTGTCGACGCCTGG
CACCTGATTGCAGACAACAGCAACGGCCAGCTTTTGATCCGCGGCGAATCAGACACATTTCTCATTGAGTTGCAA
CAGCCATGTGCTGGCCGCATGGAGCCCGACAGGCCGCAAGGAATCATCGACTATACGTCTATTACCAAGCACATT
ATCCCTCACCAAGAGACACTGCCACCACCCAGTCTGACGCCGCACTGGAACCACGAGCTCTACTTCTCAAGCCTG
GAGCGCTTCCACGCAGAAAAAAACAATGTCAATCGCTGGGGCTCCTTGTTCATGTATGGAGAAGTTGTCACAAGC
ACCAACTCGCTTCTAGAAAAAAACCCAGCCTTCATGTCTACATTGCCCACGGGATTCGTCTTTTCCGCATCCACT
CAACTTTCTGCGCGGGGCCGTGGAAACAACGCTTGGGTCGCTCCTCGCGGTGCCCTCATGTTTTCCGCCATCATC
AGTCATCCAGCCCGACTCGCTGCGTCTCGGCCCATCGTCTTTACTCAATATGTGGCTGCCATTGCCATTGTCGAG
GCTATTCAGTCTCTGGGTGCAGGATACGAAAAGCTGCCAGTCAAGTTAAAATGGCCCAACGATATTTATGCTCTC
GATCCCGCTTCTGCCTCGCAACGCTATGTCAAGGTTGGCGGTATTCTTAGCCAGTGCTGCTACTTTGATGGTTCC
TATCAGATTGTCCTGGGCATAGGCATAAATGCAAGCAACCCACGCCCGACTACCTCTCTTTCCAGCCTCGCTCCG
CCTCATGCAGCCCCTCTGCAACTTGAAGTCCTCCTTGCGCGTCTGCTTGCTAGTCTTGAGGCTGCCTACTCGCAG
TTTCTGCGCGAAGGCTTCTCGATCGATCTTGAACATCGCTACTATCGTCATTGGCTGCACACCGGACAACTGGTG
CAACTCGATACCCAAGGCGGCGAGCGGGCGCGTGTACTTGGCATCACAAGCGACTGGGGAATGCTGCGCGTCGAA
CAGACTGACCAAGACGGCAGGGGCACAGGCAAGATTTGGACCCTGCAGAGCGATGAAAACAGCTTCGACTTCTGG
AAAGGTCTTGTACGCAGAAAGCTGTAG
Gene >OphauG2|7535
ATGTCCAGCAGACGGCTCAACGTCCTTGTATACACGGGCAGGCAGTGCCTTTTCTTGCCATGGACTGGCGCCAGA
GGCTGACTCGGCTCGCCAGGCACCGGCACCAGCGTCGAGTCGGTTCGGCAGTGCGTCTACTCGCTGCAATGCCTA
GTCTCCGACACATACGCCGTTGCGCCAGTCAACGAGACAACGCTTCTCAAGGAGCCCTGGGCAGCGACGTGTGCT
CTTCTTGTCATCCCGGGCGGCGCCGACCTGGGCTACTGCCGCGTCCTCAACGGGGCTGGAAACCGGCTCATCAGC
GACTACGTCCGGCGAGGCGGGGCCTATCTCGGCTTCTGTGCTGGCGCCTACTATGCAAGTGGCCGCTGCGAGTTT
GAGGTGGGCAATGGCGAGCTCGAGGTTATCGGAAGCCGCGAGCTGGCCCTGTTCCCCGGCATCTGTCGCGGCGCT
GCCTTTTCAGGCTTCGAGTACGGCAGCGAGAGGGGAGCCCGGGCCTGTCATGTCGCAGTCCATGGTGGCGTCTTT
GAGCCCCAGCAGGCCGTGCCAGACAGCTTTGCCTGCTACTTCAACGGCGGCGGCGTCTTTGTCGATGCCGCCAGC
GTCACAAGCCGCAAGGTGCAAGTCTTGGCCTCGTATCGCGACGACATTCATGTGGATGGTGGTGACGGCAAGGCT
GCCATGGTTCTGTGCCACGTGGGCGAGGGCAAGGCGCTCCTCACAGGGCCGCATCCCGAGTGAGTGAAGCGCTTG
TCGTTGCCGCTCAAAGCGCTCACGACCCCAGATTTGCTGCTGCCAATCTCTCGCCTCAGCCCAGCCTGCCCGGAT
ACGACCGGCTCATTCAGGAGCTCGAGGCCAACGATAAAGCGCGCGTCAGCTTCCTCAGGGCCTGCCTGTGCAAGC
TGGGGCTTGAGGTTGGTCTAGACGACGCTCCAGTGGCGACGCTGTCGAGCATTTACCTTTGCTCCACCGACCCTC
CCAGAGTCGCGCGCCTTGTCGACGCCTGGCACCTGATTGCAGACAACAGCAACGGCCAGCTTTTGATCCGCGGCG
AATCAGACACATTTCTCATTGAGTTGCAACAGCCATGTGCTGGCCGCATGGAGCCCGACAGGCCGCAAGGAATCA
TCGACTATACGTCTATTACCAAGCACATTATCCCTCACCAAGAGACACTGCCACCACCCAGTCTGACGCCGCACT
GGAACCACGAGCTCTACTTCTCAAGCCTGGAGCGCTTCCACGCAGAAAAAAACAATGTCAATCGCTGGGGCTCCT
TGTTCATGTATGGAGAAGTTGTCACAAGCACCAACTCGCTTCTAGAAAAGTATTCCCTCATCCTCCCCCTTGCTT
CCCATTCCCATCAAAAGCCTCTGGCTCAACTGCCCATTAGAAACCCAGCCTTCATGTCTACATTGCCCACGGGAT
TCGTCTTTTCCGCATCCACTCAACTTTCTGCGCGGGGCCGTGGAAACAACGCTTGGGTCGCTCCTCGCGGTGCCC
TCATGTTTTCCGCCATCATCAGTCATCCAGCCCGACTCGCTGCGTCTCGGCCCATCGTCTTTACTCAATATGTGG
CTGCCATTGCCATTGTCGAGGCTATTCAGTCTCTGGGTGCAGGATACGAAAAGCTGCCAGTCAAGTTAAAATGGC
CCAACGATATTTGTGCCTCCCCATGACCAATACTCGATACACCGGTTGTATTATGCTGACTGCGTGTAGATGCTC
TCGATCCCGCTTCTGCCTCGCAACGCTATGTCAAGGTTGGCGGTATTCTTAGCCAGTGCTGCTACTTTGATGGTT
CCTATCAGATTGTCCTGGGCATAGGCATAAATGCAAGCAACCCACGCCCGACTACCTCTCTTTCCAGCCTCGCTC
CGCCTCATGCAGCCCCTCTGCAACTTGAAGTCCTCCTTGCGCGTCTGCTTGCTAGTCTTGAGGCTGCCTACTCGC
AGTTTCTGCGCGAAGGCTTCTCGATCGATCTTGAACATCGCTACTATCGTCATTGGCTGCACACCGGACAACTGG
TGCAACTCGATACCCAAGGCGGCGAGCGGGCGCGTGTACTTGGCATCACAAGCGACTGGGGAATGCTGCGCGTCG
AACAGACTGACCAAGACGGCAGGGGCACAGGCAAGATTTGGACCCTGCAGAGCGATGAAAACAGCTTCGACTTCT
GGAAAGGTCTTGTACGCAGAAAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail