Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7532
Gene name
LocationContig_89:24668..25586
Strand+
Gene length (bp)918
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01294 Ribosomal_L13e Ribosomal protein L13e 4.6E-76 9 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59931|RL13_CANAL 60S ribosomal protein L13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL13 PE=3 SV=1 1 195 1.0E-60
sp|Q90YV5|RL13_ICTPU 60S ribosomal protein L13 OS=Ictalurus punctatus GN=rpl13 PE=2 SV=3 1 212 6.0E-58
sp|P41125|RL13_CHICK 60S ribosomal protein L13 OS=Gallus gallus GN=RPL13 PE=2 SV=2 1 212 4.0E-56
sp|Q90Z10|RL13_DANRE 60S ribosomal protein L13 OS=Danio rerio GN=rpl13 PE=2 SV=3 1 212 9.0E-56
sp|O74175|RL13_SCHPO 60S ribosomal protein L13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl13 PE=1 SV=1 1 157 1.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59931|RL13_CANAL 60S ribosomal protein L13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL13 PE=3 SV=1 1 195 1.0E-60
sp|Q90YV5|RL13_ICTPU 60S ribosomal protein L13 OS=Ictalurus punctatus GN=rpl13 PE=2 SV=3 1 212 6.0E-58
sp|P41125|RL13_CHICK 60S ribosomal protein L13 OS=Gallus gallus GN=RPL13 PE=2 SV=2 1 212 4.0E-56
sp|Q90Z10|RL13_DANRE 60S ribosomal protein L13 OS=Danio rerio GN=rpl13 PE=2 SV=3 1 212 9.0E-56
sp|O74175|RL13_SCHPO 60S ribosomal protein L13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl13 PE=1 SV=1 1 157 1.0E-55
sp|P41129|RL132_BRANA 60S ribosomal protein L13-2 OS=Brassica napus PE=2 SV=1 3 208 7.0E-55
sp|Q876B2|RL13_SACEX 60S ribosomal protein L13 OS=Saccharomyces exiguus GN=RPL13 PE=3 SV=1 1 195 1.0E-54
sp|P41128|RL131_BRANA 60S ribosomal protein L13-1 OS=Brassica napus PE=2 SV=1 3 208 1.0E-53
sp|P41123|RL13_RAT 60S ribosomal protein L13 OS=Rattus norvegicus GN=Rpl13 PE=1 SV=2 1 212 1.0E-52
sp|P26373|RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens GN=RPL13 PE=1 SV=4 1 212 2.0E-52
sp|Q56JZ1|RL13_BOVIN 60S ribosomal protein L13 OS=Bos taurus GN=RPL13 PE=2 SV=3 1 212 2.0E-52
sp|P47963|RL13_MOUSE 60S ribosomal protein L13 OS=Mus musculus GN=Rpl13 PE=1 SV=3 1 212 2.0E-52
sp|Q9Z313|RL13_CRIGR 60S ribosomal protein L13 OS=Cricetulus griseus GN=RPL13 PE=2 SV=3 1 212 8.0E-52
sp|P91128|RL13_CAEEL 60S ribosomal protein L13 OS=Caenorhabditis elegans GN=rpl-13 PE=3 SV=1 1 206 9.0E-51
sp|Q12690|RL13A_YEAST 60S ribosomal protein L13-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL13A PE=1 SV=1 1 195 1.0E-50
sp|Q9FF90|RL133_ARATH 60S ribosomal protein L13-3 OS=Arabidopsis thaliana GN=RPL13D PE=1 SV=1 3 190 2.0E-50
sp|O48513|RL13_CHLSW 60S ribosomal protein L13 OS=Chlamydomonas sp. (strain W80) GN=RPL13 PE=2 SV=1 3 205 9.0E-50
sp|P41127|RL131_ARATH 60S ribosomal protein L13-1 OS=Arabidopsis thaliana GN=RPL13B PE=1 SV=1 3 195 3.0E-49
sp|P40212|RL13B_YEAST 60S ribosomal protein L13-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL13B PE=1 SV=1 1 195 2.0E-47
sp|Q54E20|RL13_DICDI 60S ribosomal protein L13 OS=Dictyostelium discoideum GN=rpl13 PE=1 SV=1 5 197 5.0E-47
sp|P41126|RL13_DROME 60S ribosomal protein L13 OS=Drosophila melanogaster GN=RpL13 PE=1 SV=1 4 212 3.0E-46
sp|Q95043|RL13_SCHMA 60S ribosomal protein L13 OS=Schistosoma mansoni GN=RPL13 PE=2 SV=1 6 157 2.0E-45
sp|Q9SMT4|RL132_ARATH Putative 60S ribosomal protein L13-2 OS=Arabidopsis thaliana GN=RPL13C PE=3 SV=1 3 201 1.0E-44
sp|Q962U1|RL13_SPOFR 60S ribosomal protein L13 OS=Spodoptera frugiperda GN=RpL13 PE=2 SV=1 4 206 4.0E-44
sp|P49627|RL13_TOBAC 60S ribosomal protein L13 OS=Nicotiana tabacum GN=RPL13 PE=2 SV=1 11 200 6.0E-44
sp|P0DJ58|RL13_TETTS 60S ribosomal protein L13 OS=Tetrahymena thermophila (strain SB210) GN=RPL13 PE=1 SV=1 3 162 7.0E-40
sp|O46157|RL13_LUMRU 60S ribosomal protein L13 OS=Lumbricus rubellus GN=RPL13 PE=2 SV=1 26 203 3.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3362
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7532 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6972
Ophiocordyceps camponoti-floridani Ophcf2|01101
Ophiocordyceps camponoti-rufipedis Ophun1|255
Ophiocordyceps kimflemingae Ophio5|6848
Ophiocordyceps subramaniannii Hirsu2|6251

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7532
MAIKHNQKIVNNHFRKDWQRRVRTHFDQPGKKVSRRTARQAKAAALAPRPVDKLRPIVRCPTIKYNRKVRAGRGF
TLAELKEAGIPRLFAPTIGISVDHRRQNLSEESLTVNVARLKAYKERLILLPRRSNAPKKGDTKTDLSKVEKATH
ISSTMPIPSLSRGFLEIKKSEMPRPVEGTAYMKLRMARSNLRHQGAREKRAREKSEAETAKK*
Coding >OphauG2|7532
ATGGCGATCAAGCACAACCAGAAGATTGTGAACAACCACTTCCGCAAGGATTGGCAGCGGAGGGTTCGCACACAT
TTCGACCAACCCGGGAAGAAGGTTTCTAGGCGCACTGCCCGTCAGGCAAAGGCCGCCGCCCTTGCGCCTCGTCCC
GTTGACAAGCTCCGCCCAATTGTGCGTTGCCCGACGATCAAGTACAACCGCAAGGTTCGAGCTGGTCGAGGTTTC
ACTCTTGCTGAGCTTAAGGAGGCTGGAATTCCCCGACTCTTCGCTCCCACTATTGGCATCTCGGTCGACCACCGC
CGGCAAAACCTTAGTGAGGAGAGTCTGACCGTCAACGTGGCTCGCCTCAAAGCATACAAGGAGCGCCTAATTCTT
CTTCCTCGGAGATCCAATGCTCCCAAGAAGGGCGACACCAAGACGGACCTGTCCAAGGTCGAAAAGGCCACTCAT
ATTTCTTCCACAATGCCTATTCCCTCCCTGTCTCGTGGCTTCTTGGAAATCAAGAAGAGTGAGATGCCCAGGCCC
GTCGAGGGTACTGCCTACATGAAGCTGCGTATGGCTCGCAGCAATCTACGGCACCAGGGCGCTCGCGAGAAGCGA
GCCAGGGAGAAGAGCGAGGCCGAGACAGCCAAGAAATAA
Transcript >OphauG2|7532
ATGGCGATCAAGCACAACCAGAAGATTGTGAACAACCACTTCCGCAAGGATTGGCAGCGGAGGGTTCGCACACAT
TTCGACCAACCCGGGAAGAAGGTTTCTAGGCGCACTGCCCGTCAGGCAAAGGCCGCCGCCCTTGCGCCTCGTCCC
GTTGACAAGCTCCGCCCAATTGTGCGTTGCCCGACGATCAAGTACAACCGCAAGGTTCGAGCTGGTCGAGGTTTC
ACTCTTGCTGAGCTTAAGGAGGCTGGAATTCCCCGACTCTTCGCTCCCACTATTGGCATCTCGGTCGACCACCGC
CGGCAAAACCTTAGTGAGGAGAGTCTGACCGTCAACGTGGCTCGCCTCAAAGCATACAAGGAGCGCCTAATTCTT
CTTCCTCGGAGATCCAATGCTCCCAAGAAGGGCGACACCAAGACGGACCTGTCCAAGGTCGAAAAGGCCACTCAT
ATTTCTTCCACAATGCCTATTCCCTCCCTGTCTCGTGGCTTCTTGGAAATCAAGAAGAGTGAGATGCCCAGGCCC
GTCGAGGGTACTGCCTACATGAAGCTGCGTATGGCTCGCAGCAATCTACGGCACCAGGGCGCTCGCGAGAAGCGA
GCCAGGGAGAAGAGCGAGGCCGAGACAGCCAAGAAATAA
Gene >OphauG2|7532
ATGGTATGCATTCTCCAACGACCAGTCACTGTACTCGCAAAAGTGTCATGCTGAGTTTGAATAAAATATAGGCGA
TCAAGCACAACCAGAAGATTGTGAACAACCGTGAGCTACAAGGCCCTTTCTTCTGCCAACAAGTAACAAACGAAA
TCTGACTGGAATTGGATTATAGACTTCCGCAAGGATTGGCAGCGGAGGGTTCGCACACATTTCGACCAAGTATGA
GAATCCAAGCTGCTGGCTACTTACACAGGAATTGCGAATTAACAATTCTTTGAACAGCCCGGGAAGAAGGTTTCT
AGGCGCACTGCCCGTCAGGCAAAGGCCGCCGCCCTTGCGCCTCGTCCCGTTGACAAGCTCCGCCCAATTGTGCGT
TGCCCGACGATCAAGTACAACCGCAAGGTTCGAGCTGGTCGAGGTTTCACTCTTGCTGAGCTTAAGGTATGTGGC
AAGCAGAGCCGAGGCTCTAAGAAAAATAGCCCAGTCAGAAATATATGGATGGAAGCTAATTGCCATCTGCAGGAG
GCTGGAATTCCCCGACTCTTCGCTCCCACTATTGGCATCTCGGTCGACCACCGCCGGCAAAACCTTAGTGAGGAG
AGTCTGACCGTCAACGTGGCTCGCCTCAAAGCATACAAGGAGCGCCTAATTCTTCTTCCTCGGAGATCCAATGCT
CCCAAGAAGGGCGACACCAAGACGGACCTGTCCAAGGTCGAAAAGGCCACTCATATTTCTTCCACAATGCCTATT
CCCTCCCTGTCTCGTGGCTTCTTGGAAATCAAGAAGAGTGAGATGCCCAGGCCCGTCGAGGGTACTGCCTACATG
AAGCTGCGTATGGCTCGCAGCAATCTACGGCACCAGGGCGCTCGCGAGAAGCGAGCCAGGGAGAAGAGCGAGGCC
GAGACAGCCAAGAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail