Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7513
Gene name
LocationContig_888:1352..2006
Strand-
Gene length (bp)654
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09791 Oxidored-like Oxidoreductase-like protein, N-terminal 7.5E-25 103 146

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02873|YP107_YEAST UPF0651 protein YPL107W, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL107W PE=1 SV=1 70 149 2.0E-16
sp|Q9USH2|YJH2_SCHPO UPF0651 protein P31B10.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP31B10.02 PE=3 SV=1 105 148 7.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7513
MYLGQPSPPVQTLPLPSLSSEDAPAPKKQPRPQGKKKPGRKPKIASIESVASPISSAGTSPPVSSPPPKSAAEKA
RIVFGSRLLGPAEQADRLATKRSQSSYVAGVLVPPRPEEPDNCCMSGCVNCVWDRFREDMEEWTAKQSEAQRRLK
QGRDADSVDSDGGRTGVGLDMPMADTQLTQDMWNDDIFKTLPVGIREFMKQEKRLKEKHEREKGAAG*
Coding >OphauG2|7513
ATGTACCTTGGCCAGCCAAGCCCCCCTGTGCAAACTTTGCCCTTGCCGTCGCTGTCTTCTGAGGACGCGCCCGCG
CCCAAAAAACAGCCCAGGCCCCAAGGCAAAAAGAAGCCCGGTCGCAAGCCAAAGATTGCTTCCATTGAGTCAGTT
GCATCTCCAATTTCGTCTGCTGGCACATCGCCGCCGGTGTCCTCGCCGCCGCCCAAGTCCGCTGCCGAGAAAGCA
CGAATCGTTTTTGGCTCACGTCTTCTCGGCCCCGCAGAACAAGCTGATCGTCTCGCCACCAAGCGCTCCCAGTCA
AGCTATGTCGCCGGCGTCCTTGTGCCTCCACGACCCGAAGAGCCCGATAACTGTTGCATGAGCGGTTGTGTCAAC
TGTGTCTGGGATCGCTTCCGCGAAGACATGGAGGAATGGACAGCCAAGCAGAGCGAGGCACAGAGGCGACTGAAA
CAGGGGCGCGATGCTGACAGCGTCGACTCGGACGGCGGTAGGACAGGCGTGGGCTTAGATATGCCCATGGCCGAT
ACACAACTAACACAGGATATGTGGAACGACGACATATTCAAGACGTTGCCAGTTGGTATCCGCGAGTTCATGAAG
CAGGAGAAGCGGCTTAAGGAGAAGCACGAGCGCGAGAAAGGTGCTGCAGGATAA
Transcript >OphauG2|7513
ATGTACCTTGGCCAGCCAAGCCCCCCTGTGCAAACTTTGCCCTTGCCGTCGCTGTCTTCTGAGGACGCGCCCGCG
CCCAAAAAACAGCCCAGGCCCCAAGGCAAAAAGAAGCCCGGTCGCAAGCCAAAGATTGCTTCCATTGAGTCAGTT
GCATCTCCAATTTCGTCTGCTGGCACATCGCCGCCGGTGTCCTCGCCGCCGCCCAAGTCCGCTGCCGAGAAAGCA
CGAATCGTTTTTGGCTCACGTCTTCTCGGCCCCGCAGAACAAGCTGATCGTCTCGCCACCAAGCGCTCCCAGTCA
AGCTATGTCGCCGGCGTCCTTGTGCCTCCACGACCCGAAGAGCCCGATAACTGTTGCATGAGCGGTTGTGTCAAC
TGTGTCTGGGATCGCTTCCGCGAAGACATGGAGGAATGGACAGCCAAGCAGAGCGAGGCACAGAGGCGACTGAAA
CAGGGGCGCGATGCTGACAGCGTCGACTCGGACGGCGGTAGGACAGGCGTGGGCTTAGATATGCCCATGGCCGAT
ACACAACTAACACAGGATATGTGGAACGACGACATATTCAAGACGTTGCCAGTTGGTATCCGCGAGTTCATGAAG
CAGGAGAAGCGGCTTAAGGAGAAGCACGAGCGCGAGAAAGGTGCTGCAGGATAA
Gene >OphauG2|7513
ATGTACCTTGGCCAGCCAAGCCCCCCTGTGCAAACTTTGCCCTTGCCGTCGCTGTCTTCTGAGGACGCGCCCGCG
CCCAAAAAACAGCCCAGGCCCCAAGGCAAAAAGAAGCCCGGTCGCAAGCCAAAGATTGCTTCCATTGAGTCAGTT
GCATCTCCAATTTCGTCTGCTGGCACATCGCCGCCGGTGTCCTCGCCGCCGCCCAAGTCCGCTGCCGAGAAAGCA
CGAATCGTTTTTGGCTCACGTCTTCTCGGCCCCGCAGAACAAGCTGATCGTCTCGCCACCAAGCGCTCCCAGTCA
AGCTATGTCGCCGGCGTCCTTGTGCCTCCACGACCCGAAGAGCCCGATAACTGTTGCATGAGCGGTTGTGTCAAC
TGTGTCTGGGATCGCTTCCGCGAAGACATGGAGGAATGGACAGCCAAGCAGAGCGAGGCACAGAGGCGACTGAAA
CAGGGGCGCGATGCTGACAGCGTCGACTCGGACGGCGGTAGGACAGGCGTGGGCTTAGATATGCCCATGGCCGAT
ACACAACTAACACAGGATATGTGGAACGACGACATATTCAAGACGTTGCCAGTTGGTATCCGCGAGTTCATGAAG
CAGGAGAAGCGGCTTAAGGAGAAGCACGAGCGCGAGAAAGGTGCTGCAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail