Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7482
Gene name
LocationContig_88:11643..13167
Strand-
Gene length (bp)1524
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.8E-19 12 323
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.6E-09 177 247
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 9.5E-06 106 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B5FXE5|AIFM2_TAEGU Apoptosis-inducing factor 2 OS=Taeniopygia guttata GN=AIFM2 PE=2 SV=1 56 324 2.0E-11
sp|Q54NS8|AIFB_DICDI Apoptosis-inducing factor homolog B OS=Dictyostelium discoideum GN=aifB PE=3 SV=1 57 324 1.0E-09

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7482
MGSVPKPEVPTYKVFIAGGSYCGLSAAANLLDLGQGLSPRMATQPYDHHPDMPRVNWDITVADERDGFYHLIGSP
LALADTAYAEKAWVKFKHLPGLQNPQIKFLHSTVASIDPVAKQAVTVDSTTGEKKTHAYDFFVAATGLRRVWPVV
PQSLHRKKYLVEVGRHINAVSKAKHGVVVVGGGAVGIEMAAELKLVKPDIKVTLVHSRDQLLSSEELSDECKAKA
LELLKDPAQVEVLMNHRVASKERIDTSDGSLAWQIEFTNGHKMVASEVIMAVSKSVPTSSYLPASVLNDEGYVNT
QLNGRLPSNLHNHEYHYCAGDLANRTGIRRCGGAMHGGHYIAENIHKTILHERFGQDPKFMEFSAYVPPMIGLAI
GPIALCSGPEGTDWGDEVMENFFNDNLGFDICYNWIGLGGRKQEDKVSTQNE*
Coding >OphauG2|7482
ATGGGCTCAGTACCAAAGCCAGAAGTCCCAACCTACAAGGTTTTCATCGCTGGCGGCTCCTATTGCGGCCTGTCT
GCCGCAGCCAACCTGCTGGATCTGGGCCAAGGACTTTCCCCTCGCATGGCTACTCAGCCGTATGACCATCATCCA
GACATGCCTCGAGTCAATTGGGACATTACCGTTGCCGATGAGAGAGACGGCTTCTATCACTTGATCGGATCGCCT
TTGGCCCTGGCCGACACTGCATACGCCGAAAAAGCTTGGGTCAAATTTAAGCATCTTCCAGGGCTGCAGAATCCC
CAAATCAAGTTTCTTCATAGCACTGTCGCAAGCATCGATCCCGTCGCCAAACAAGCCGTAACCGTCGATAGCACG
ACTGGAGAAAAGAAGACACACGCATACGACTTCTTCGTAGCAGCCACCGGACTGCGCCGAGTGTGGCCCGTCGTA
CCACAGTCTCTTCACCGCAAGAAATATCTGGTTGAGGTTGGTCGACATATCAATGCCGTCTCCAAAGCCAAACAT
GGCGTCGTTGTTGTTGGTGGTGGTGCCGTCGGTATAGAAATGGCTGCCGAGCTCAAGCTTGTGAAGCCCGACATC
AAGGTTACCCTCGTGCATTCACGAGACCAACTTCTCTCGTCGGAGGAACTGTCTGACGAGTGTAAAGCCAAGGCT
CTCGAGCTACTCAAGGACCCAGCTCAAGTTGAAGTGCTCATGAACCACCGTGTCGCTAGCAAGGAACGTATCGAC
ACTTCTGACGGATCCTTAGCTTGGCAAATTGAATTCACCAATGGTCACAAAATGGTGGCTAGCGAGGTCATCATG
GCCGTTTCCAAAAGCGTTCCCACCTCATCCTACCTTCCAGCGTCCGTCCTCAATGATGAGGGATATGTCAACACC
CAGTTGAACGGACGCTTACCGTCTAACTTGCACAATCATGAATACCATTATTGCGCAGGCGACTTGGCCAATCGA
ACCGGCATTAGGCGCTGTGGAGGAGCCATGCACGGCGGCCATTATATAGCTGAGAACATCCACAAGACCATCCTC
CACGAGCGTTTCGGCCAAGATCCCAAATTCATGGAATTTAGTGCATACGTGCCACCCATGATTGGCCTCGCCATC
GGTCCAATTGCGCTGTGCTCTGGTCCTGAGGGCACTGATTGGGGCGATGAAGTCATGGAGAACTTCTTCAATGAC
AATTTAGGATTTGATATTTGCTATAACTGGATAGGCCTCGGAGGCAGGAAGCAAGAAGACAAGGTCAGTACGCAA
AATGAATAA
Transcript >OphauG2|7482
ATGGGCTCAGTACCAAAGCCAGAAGTCCCAACCTACAAGGTTTTCATCGCTGGCGGCTCCTATTGCGGCCTGTCT
GCCGCAGCCAACCTGCTGGATCTGGGCCAAGGACTTTCCCCTCGCATGGCTACTCAGCCGTATGACCATCATCCA
GACATGCCTCGAGTCAATTGGGACATTACCGTTGCCGATGAGAGAGACGGCTTCTATCACTTGATCGGATCGCCT
TTGGCCCTGGCCGACACTGCATACGCCGAAAAAGCTTGGGTCAAATTTAAGCATCTTCCAGGGCTGCAGAATCCC
CAAATCAAGTTTCTTCATAGCACTGTCGCAAGCATCGATCCCGTCGCCAAACAAGCCGTAACCGTCGATAGCACG
ACTGGAGAAAAGAAGACACACGCATACGACTTCTTCGTAGCAGCCACCGGACTGCGCCGAGTGTGGCCCGTCGTA
CCACAGTCTCTTCACCGCAAGAAATATCTGGTTGAGGTTGGTCGACATATCAATGCCGTCTCCAAAGCCAAACAT
GGCGTCGTTGTTGTTGGTGGTGGTGCCGTCGGTATAGAAATGGCTGCCGAGCTCAAGCTTGTGAAGCCCGACATC
AAGGTTACCCTCGTGCATTCACGAGACCAACTTCTCTCGTCGGAGGAACTGTCTGACGAGTGTAAAGCCAAGGCT
CTCGAGCTACTCAAGGACCCAGCTCAAGTTGAAGTGCTCATGAACCACCGTGTCGCTAGCAAGGAACGTATCGAC
ACTTCTGACGGATCCTTAGCTTGGCAAATTGAATTCACCAATGGTCACAAAATGGTGGCTAGCGAGGTCATCATG
GCCGTTTCCAAAAGCGTTCCCACCTCATCCTACCTTCCAGCGTCCGTCCTCAATGATGAGGGATATGTCAACACC
CAGTTGAACGGACGCTTACCGTCTAACTTGCACAATCATGAATACCATTATTGCGCAGGCGACTTGGCCAATCGA
ACCGGCATTAGGCGCTGTGGAGGAGCCATGCACGGCGGCCATTATATAGCTGAGAACATCCACAAGACCATCCTC
CACGAGCGTTTCGGCCAAGATCCCAAATTCATGGAATTTAGTGCATACGTGCCACCCATGATTGGCCTCGCCATC
GGTCCAATTGCGCTGTGCTCTGGTCCTGAGGGCACTGATTGGGGCGATGAAGTCATGGAGAACTTCTTCAATGAC
AATTTAGGATTTGATATTTGCTATAACTGGATAGGCCTCGGAGGCAGGAAGCAAGAAGACAAGGTCAGTACGCAA
AATGAATAA
Gene >OphauG2|7482
ATGGGCTCAGTACCAAAGCCAGAAGTCCCAACCTACAAGGTTTTCATCGCTGGCGGCTCCTATTGCGGCCTGTCT
GCCGCAGCCAACCTGCTGGATCTGGGCCAAGGACTTTCCCCTCGCATGGCTACTCAGCCGTATGACCATCATCCA
GACATGCCTCGAGTCAATTGGGACATTACCGTTGCCGATGAGAGAGACGGCTTCTGTGCGTCATTGTTACCGTCT
CTTCTTTTTCTTGTCCCAGCTTTTGGAAGCCCATGGAGTGTCGCAACTTGCCATGTTTCTGTTCTTTCTGACACG
TCTCTCTGCCCTCCTTGCTAGATCACTTGATCGGATCGCCTTTGGCCCTGGCCGACACTGCATACGCCGAAAAAG
CTTGGGTCAAATTTAAGCATCTTCCAGGGCTGCAGAATCCCCAAATCAAGTTTCTTCATAGCACTGTCGCAAGCA
TCGATCCCGTCGCCAAACAAGCCGTAACCGTCGATAGCACGACTGGAGAAAAGAAGACACACGCATACGACTTCT
TCGTAGCAGCCACCGGACTGCGCCGAGTGTGGCCCGTCGTACCACAGTCTCTTCACCGCAAGAAATATCTGGTTG
AGGTTGGTCGACATATCAATGCCGTCTCCAAAGCCAAACATGGCGTCGTTGTTGTTGGTGGTGGTGCCGTCGGTA
TAGAAATGGCTGCCGAGCTCAAGCTTGTGAAGCCCGACATCAAGGTTACCCTCGTGCATTCACGAGACCAACTTC
TCTCGTCGGAGGAACTGTCTGACGAGTGTAAAGCCAAGGCTCTCGAGCTACTCAAGGACCCAGCTCAAGTTGAAG
TGCTCATGAACCACCGTGTCGCTAGCAAGGAACGTATCGACACTTCTGACGGATCCTTAGCTTGGCAAATTGAAT
TCACCAATGGTCACAAAATGGTGGCTAGCGAGGTCATCATGGCCGTTTCCAAAAGCGTTCCCACCTCATCCTACC
TTCCAGCGTCCGTCCTCAATGATGAGGGATATGTCAACACCCAGTTGAAGTAGAGTCTCATCTTGATTCACTTCT
TTTCCAATTGACTTGTTGCTGACTTGGCCACAGCGGACGCTTACCGTCTAACTTGCACAATCATGAATACCATTA
TTGCGCAGGCGACTTGGCCAATCGAACCGGCATTAGGCGCTGTGGAGGAGCCATGCACGGCGGCCATTATATAGC
TGAGAACATCCACAAGACCATCCTCCACGAGCGTTTCGGCCAAGATCCCAAATTCATGGAATTTAGTGCATACGT
GCCACCCATGATTGGCCTCGCCATCGGTCCAATTGCGCTGTGCTCTGGTCCTGAGGGCACTGATTGGGGCGATGA
AGTCATGGAGAACTTCTTCAATGACAATTTAGGATTTGATAGTAGGTGTCATAACCAACGTTTACCTCGCAGAGA
AAATGCCTCAGAAGCTTACAAGGCGACGTAGTTTGCTATAACTGGATAGGCCTCGGAGGCAGGAAGCAAGAAGAC
AAGGTCAGTACGCAAAATGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail