Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7481
Gene name
LocationContig_88:9335..10724
Strand-
Gene length (bp)1389
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain 4.3E-46 280 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE3|YNZ6_SCHPO Putative lysine N-acyltransferase C17G9.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17G9.06c PE=3 SV=1 248 439 3.0E-50
sp|Q47317|IUCB_ECOLX N(6)-hydroxylysine O-acetyltransferase OS=Escherichia coli GN=iucB PE=1 SV=1 252 439 1.0E-29
sp|Q9Z3Q9|RHBD_RHIME Rhizobactin siderophore biosynthesis protein RhbD OS=Rhizobium meliloti (strain 1021) GN=rhbD PE=3 SV=1 256 440 9.0E-27
sp|Q73ZP9|MBTK_MYCPA Lysine N-acyltransferase MbtK OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtK PE=3 SV=2 263 405 7.0E-10
sp|P9WK15|MBTK_MYCTU Lysine N-acyltransferase MbtK OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtK PE=1 SV=1 263 406 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE3|YNZ6_SCHPO Putative lysine N-acyltransferase C17G9.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17G9.06c PE=3 SV=1 248 439 3.0E-50
sp|Q47317|IUCB_ECOLX N(6)-hydroxylysine O-acetyltransferase OS=Escherichia coli GN=iucB PE=1 SV=1 252 439 1.0E-29
sp|Q9Z3Q9|RHBD_RHIME Rhizobactin siderophore biosynthesis protein RhbD OS=Rhizobium meliloti (strain 1021) GN=rhbD PE=3 SV=1 256 440 9.0E-27
sp|Q73ZP9|MBTK_MYCPA Lysine N-acyltransferase MbtK OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtK PE=3 SV=2 263 405 7.0E-10
sp|P9WK15|MBTK_MYCTU Lysine N-acyltransferase MbtK OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtK PE=1 SV=1 263 406 2.0E-08
sp|P9WK14|MBTK_MYCTO Lysine N-acyltransferase MbtK OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtK PE=3 SV=1 263 406 2.0E-08
sp|P64820|MBTK_MYCBO Lysine N-acyltransferase MbtK OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtK PE=3 SV=1 263 406 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7481
MAEAPVRVVGDAGLLSSLAADKTVLKLPHPYLTEYTVVKSASGVEINSETDTLALYQLCEKAGSSQVPLPTQLVN
EALFFSGPANLKSSEQPPVSDNSPWARARRSPSWTVAWEGAVPLVAHIWLLVYVLCTLEPDAESQRLELHGPGAA
ALGKKLKDVALAIGHPWRVHERAQSDETSATRSQVIALRSTFWQGAGCPFGPRSVWCPEGSAAAALYPPAPLHHV
VTVSSAGDPQCPERRKQSWHPVRAGKPTPGSIIYSRWIPHLSETFSMVALDCDNTEHLQLFHQWQNDPRVSQGWN
ETGTFEQHRQYLQNIEADAHQVAILARWDDSFFAYFEVYWAKEDLLGSYYDAGDFDRGRHSLVGDVRFRGRHRVS
AWWSSLMHYLFLDDTRTMAVVGEPRDSNSTVVMYDLIHGFGLEAFVDMPHKRSALVRCSRSRFFQLCPLGDNEKA
VGGVRIGLVAKL*
Coding >OphauG2|7481
ATGGCCGAAGCTCCTGTAAGGGTTGTTGGGGACGCGGGGCTCCTGTCTTCGCTGGCAGCCGACAAGACGGTACTC
AAGCTTCCACACCCATATTTAACCGAGTACACGGTAGTGAAATCTGCAAGCGGTGTCGAGATCAATTCCGAAACG
GATACATTGGCGCTCTATCAACTATGCGAGAAGGCTGGGTCGTCCCAGGTTCCTCTACCTACCCAGCTTGTCAAC
GAAGCCCTCTTCTTCTCTGGGCCAGCAAATTTGAAGTCGAGCGAGCAACCTCCAGTATCGGACAACAGTCCTTGG
GCGCGAGCAAGACGTTCGCCATCTTGGACTGTGGCATGGGAAGGTGCAGTGCCTTTGGTGGCGCACATCTGGCTG
CTGGTTTACGTGCTCTGCACATTGGAACCTGATGCAGAGTCGCAGCGACTTGAGCTTCACGGTCCAGGGGCTGCG
GCACTTGGTAAAAAACTCAAGGACGTTGCACTAGCCATTGGGCACCCATGGCGAGTGCACGAGAGGGCACAATCA
GATGAGACAAGCGCCACACGAAGCCAAGTCATTGCACTCAGAAGCACATTCTGGCAGGGAGCAGGCTGTCCCTTT
GGGCCTCGCTCTGTCTGGTGTCCCGAAGGTTCAGCAGCAGCGGCACTCTATCCTCCAGCGCCACTGCATCATGTG
GTGACGGTCTCATCGGCTGGCGACCCGCAATGCCCAGAACGGCGCAAGCAGTCATGGCATCCCGTGCGAGCAGGC
AAGCCAACACCTGGGTCCATCATATATAGTCGTTGGATTCCGCATCTAAGCGAGACCTTCTCCATGGTGGCACTC
GACTGCGACAATACGGAGCACCTGCAGCTCTTTCACCAATGGCAAAACGATCCGCGCGTGTCGCAGGGATGGAAC
GAAACAGGCACATTCGAACAGCATCGCCAGTACTTGCAAAACATTGAAGCAGATGCTCACCAGGTGGCAATCTTG
GCGCGCTGGGACGACAGCTTCTTTGCATATTTCGAAGTGTACTGGGCCAAGGAAGACTTGCTGGGCAGCTACTAC
GACGCCGGCGACTTTGATCGAGGACGGCATTCGCTTGTGGGCGACGTGAGGTTTCGAGGCAGGCACCGTGTGTCG
GCATGGTGGAGCAGCCTGATGCATTATCTGTTCCTCGATGACACGCGCACCATGGCTGTTGTTGGCGAGCCACGC
GACTCCAATTCGACAGTCGTCATGTACGACTTGATCCACGGCTTTGGACTTGAAGCCTTCGTGGACATGCCACAT
AAACGCAGCGCCTTGGTGCGTTGTTCACGAAGCCGCTTCTTCCAGTTGTGTCCATTAGGGGATAACGAAAAGGCG
GTAGGAGGAGTGCGCATTGGCCTTGTTGCCAAGCTGTAG
Transcript >OphauG2|7481
ATGGCCGAAGCTCCTGTAAGGGTTGTTGGGGACGCGGGGCTCCTGTCTTCGCTGGCAGCCGACAAGACGGTACTC
AAGCTTCCACACCCATATTTAACCGAGTACACGGTAGTGAAATCTGCAAGCGGTGTCGAGATCAATTCCGAAACG
GATACATTGGCGCTCTATCAACTATGCGAGAAGGCTGGGTCGTCCCAGGTTCCTCTACCTACCCAGCTTGTCAAC
GAAGCCCTCTTCTTCTCTGGGCCAGCAAATTTGAAGTCGAGCGAGCAACCTCCAGTATCGGACAACAGTCCTTGG
GCGCGAGCAAGACGTTCGCCATCTTGGACTGTGGCATGGGAAGGTGCAGTGCCTTTGGTGGCGCACATCTGGCTG
CTGGTTTACGTGCTCTGCACATTGGAACCTGATGCAGAGTCGCAGCGACTTGAGCTTCACGGTCCAGGGGCTGCG
GCACTTGGTAAAAAACTCAAGGACGTTGCACTAGCCATTGGGCACCCATGGCGAGTGCACGAGAGGGCACAATCA
GATGAGACAAGCGCCACACGAAGCCAAGTCATTGCACTCAGAAGCACATTCTGGCAGGGAGCAGGCTGTCCCTTT
GGGCCTCGCTCTGTCTGGTGTCCCGAAGGTTCAGCAGCAGCGGCACTCTATCCTCCAGCGCCACTGCATCATGTG
GTGACGGTCTCATCGGCTGGCGACCCGCAATGCCCAGAACGGCGCAAGCAGTCATGGCATCCCGTGCGAGCAGGC
AAGCCAACACCTGGGTCCATCATATATAGTCGTTGGATTCCGCATCTAAGCGAGACCTTCTCCATGGTGGCACTC
GACTGCGACAATACGGAGCACCTGCAGCTCTTTCACCAATGGCAAAACGATCCGCGCGTGTCGCAGGGATGGAAC
GAAACAGGCACATTCGAACAGCATCGCCAGTACTTGCAAAACATTGAAGCAGATGCTCACCAGGTGGCAATCTTG
GCGCGCTGGGACGACAGCTTCTTTGCATATTTCGAAGTGTACTGGGCCAAGGAAGACTTGCTGGGCAGCTACTAC
GACGCCGGCGACTTTGATCGAGGACGGCATTCGCTTGTGGGCGACGTGAGGTTTCGAGGCAGGCACCGTGTGTCG
GCATGGTGGAGCAGCCTGATGCATTATCTGTTCCTCGATGACACGCGCACCATGGCTGTTGTTGGCGAGCCACGC
GACTCCAATTCGACAGTCGTCATGTACGACTTGATCCACGGCTTTGGACTTGAAGCCTTCGTGGACATGCCACAT
AAACGCAGCGCCTTGGTGCGTTGTTCACGAAGCCGCTTCTTCCAGTTGTGTCCATTAGGGGATAACGAAAAGGCG
GTAGGAGGAGTGCGCATTGGCCTTGTTGCCAAGCTGTAG
Gene >OphauG2|7481
ATGGCCGAAGCTCCTGTAAGGGTTGTTGGGGACGCGGGGCTCCTGTCTTCGCTGGCAGCCGACAAGACGGTACTC
AAGCTTCCACACCCATATTTAACCGAGTACACGGTAGTGAAATCTGCAAGCGGTGTCGAGATCAATTCCGAAACG
GATACATTGGCGCTCTATCAACTATGCGAGAAGGCTGGGTCGTCCCAGGTTCCTCTACCTACCCAGCTTGTCAAC
GAAGCCCTCTTCTTCTCTGGGCCAGCAAATTTGAAGTCGAGCGAGCAACCTCCAGTATCGGACAACAGTCCTTGG
GCGCGAGCAAGACGTTCGCCATCTTGGACTGTGGCATGGGAAGGTGCAGTGCCTTTGGTGGCGCACATCTGGCTG
CTGGTTTACGTGCTCTGCACATTGGAACCTGATGCAGAGTCGCAGCGACTTGAGCTTCACGGTCCAGGGGCTGCG
GCACTTGGTAAAAAACTCAAGGACGTTGCACTAGCCATTGGGCACCCATGGCGAGTGCACGAGAGGGCACAATCA
GATGAGACAAGCGCCACACGAAGCCAAGTCATTGCACTCAGAAGCACATTCTGGCAGGGAGCAGGCTGTCCCTTT
GGGCCTCGCTCTGTCTGGTGTCCCGAAGGTTCAGCAGCAGCGGCACTCTATCCTCCAGCGCCACTGCATCATGTG
GTGACGGTCTCATCGGCTGGCGACCCGCAATGCCCAGAACGGCGCAAGCAGTCATGGCATCCCGTGCGAGCAGGC
AAGCCAACACCTGGGTCCATCATATATAGTCGTTGGATTCCGCATCTAAGCGAGACCTTCTCCATGGTGGCACTC
GACTGCGACAATACGGAGCACCTGCAGCTCTTTCACCAATGGCAAAACGATCCGCGCGTGTCGCAGGGATGGAAC
GAAACAGGCACATTCGAACAGCATCGCCAGTACTTGCAAAACATTGAAGCAGATGCTCACCAGGTGGCAATCTTG
GCGCGCTGGGACGACAGCTTCTTTGCATATTTCGAAGTGTACTGGGCCAAGGAAGACTTGCTGGGCAGCTACTAC
GACGCCGGCGACTTTGATCGAGGACGGCATTCGCTTGTGGGCGACGTGAGGTTTCGAGGCAGGCACCGTGTGTCG
GCATGGTGGAGCAGCCTGATGCATTATCTGTTCCTCGATGACACGCGCACCATGGCTGTTGTTGGCGAGCCACGC
GACTCCAATTCGACAGTCGTCATGTACGACTTGATCCACGGCTTTGGACTTGAAGCCTTCGTGGACATGCCACAT
AAACGCAGCGCCTTGGTGCGTTGTTCACGAAGCCGCTTCTTCCAGTTGTGTCCATTAGGGGATAACGAAAAGGCG
GTAGGAGGAGTGCGCATTGGCCTTGTTGCCAAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail