Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7469
Gene name
LocationContig_875:5352..6771
Strand+
Gene length (bp)1419
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5778
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7469 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6454
Ophiocordyceps camponoti-floridani Ophcf2|05163
Ophiocordyceps camponoti-rufipedis Ophun1|1088
Ophiocordyceps kimflemingae Ophio5|3430
Ophiocordyceps subramaniannii Hirsu2|9600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7469
MPADSPHANLCKCILSAVALGYPAPTLLNWHGEFNRPEWHLAGSHIAKLESLLAVIHDLLARLDETRASQHDLVM
LVDAYDVWFQLPPSVLIERYHELNRQANDRIRMQWQAFAPGFPLGPPRQSIVVTSAKDCHPGKDSGTDPSYAHWP
PSPMPDDLYGPQTDALLAILDPARRFRKVRPRCVNSGLIMGPMAALRHALQRCAQKVERIARSGRQLWSDQALFG
QVMGDQELWREWVRELGAAWNGTTADMRHSKLPFKVRDIAAAALRNKTFDFGIGLDYNFTTIPPTCSAEEDGFFV
RLDDSTAAQQQSTKAGVPGHVRFHGLPADLKRAGRFDAALATVPWGDVPLYTDFFFGTTPVGIHHNAYVDNLKPW
RISNWWHMMWFHPHLRRLVERNLRQGPTMMAKVAHPHDSTAPDLEYWRDDNKFVTVFKPATPGEGLHMALDWDGV
CQKGPKPWHQEVFGDGMGPLLP*
Coding >OphauG2|7469
ATGCCCGCCGACTCGCCCCATGCCAACCTGTGCAAATGCATCCTGTCCGCCGTGGCTCTCGGCTACCCAGCGCCC
ACTCTGCTGAATTGGCATGGCGAGTTTAACCGCCCGGAATGGCATCTTGCAGGAAGCCACATTGCCAAGCTCGAG
AGCCTGTTGGCTGTCATCCACGACCTGCTCGCTCGCTTGGACGAGACTCGGGCCAGCCAGCACGACTTGGTCATG
CTGGTTGATGCATACGATGTTTGGTTCCAGCTGCCGCCCTCGGTCCTCATTGAGCGCTACCATGAACTGAATCGC
CAAGCCAACGACCGCATCCGCATGCAGTGGCAGGCCTTCGCTCCAGGCTTTCCCCTTGGGCCTCCTCGCCAATCC
ATCGTCGTCACAAGCGCCAAGGATTGCCATCCTGGCAAGGATTCAGGCACTGATCCGAGCTACGCCCATTGGCCC
CCGTCGCCCATGCCAGACGACCTCTATGGCCCGCAAACAGATGCCCTGCTGGCCATTCTCGACCCAGCTCGGCGC
TTTCGCAAAGTCCGCCCACGATGCGTCAACAGCGGCCTCATCATGGGCCCCATGGCCGCTCTCCGCCATGCTCTA
CAGCGCTGCGCTCAAAAGGTCGAGCGCATCGCCCGTTCCGGCCGCCAGCTGTGGAGCGACCAGGCTCTGTTTGGA
CAGGTCATGGGCGACCAGGAGCTGTGGCGCGAGTGGGTGCGAGAGCTGGGCGCTGCATGGAACGGAACAACTGCC
GACATGAGACACTCAAAGCTGCCCTTCAAGGTGCGCGACATTGCAGCCGCCGCCCTGCGCAACAAGACGTTTGAC
TTTGGCATTGGCCTCGACTACAACTTCACCACCATTCCGCCAACTTGCTCCGCCGAAGAAGATGGCTTCTTTGTC
CGCCTGGATGATTCCACCGCCGCCCAGCAGCAAAGCACAAAGGCCGGTGTTCCTGGCCATGTGCGCTTTCACGGT
CTTCCCGCCGACTTGAAGCGCGCTGGCCGTTTCGATGCCGCTCTCGCCACCGTTCCCTGGGGCGACGTGCCGCTC
TACACCGACTTTTTCTTTGGCACCACCCCCGTCGGCATCCACCATAATGCCTATGTCGATAACCTCAAGCCCTGG
CGTATCAGTAATTGGTGGCACATGATGTGGTTTCATCCGCATCTACGACGCCTTGTTGAGCGCAATCTGCGTCAA
GGGCCAACCATGATGGCAAAGGTGGCCCACCCCCATGACTCCACCGCACCAGACTTGGAGTACTGGCGAGACGAC
AACAAGTTTGTCACTGTTTTTAAGCCAGCCACTCCGGGAGAGGGTTTACACATGGCCCTTGACTGGGACGGGGTA
TGTCAAAAGGGCCCCAAGCCATGGCACCAAGAGGTTTTTGGAGACGGCATGGGGCCACTGCTGCCTTGA
Transcript >OphauG2|7469
ATGCCCGCCGACTCGCCCCATGCCAACCTGTGCAAATGCATCCTGTCCGCCGTGGCTCTCGGCTACCCAGCGCCC
ACTCTGCTGAATTGGCATGGCGAGTTTAACCGCCCGGAATGGCATCTTGCAGGAAGCCACATTGCCAAGCTCGAG
AGCCTGTTGGCTGTCATCCACGACCTGCTCGCTCGCTTGGACGAGACTCGGGCCAGCCAGCACGACTTGGTCATG
CTGGTTGATGCATACGATGTTTGGTTCCAGCTGCCGCCCTCGGTCCTCATTGAGCGCTACCATGAACTGAATCGC
CAAGCCAACGACCGCATCCGCATGCAGTGGCAGGCCTTCGCTCCAGGCTTTCCCCTTGGGCCTCCTCGCCAATCC
ATCGTCGTCACAAGCGCCAAGGATTGCCATCCTGGCAAGGATTCAGGCACTGATCCGAGCTACGCCCATTGGCCC
CCGTCGCCCATGCCAGACGACCTCTATGGCCCGCAAACAGATGCCCTGCTGGCCATTCTCGACCCAGCTCGGCGC
TTTCGCAAAGTCCGCCCACGATGCGTCAACAGCGGCCTCATCATGGGCCCCATGGCCGCTCTCCGCCATGCTCTA
CAGCGCTGCGCTCAAAAGGTCGAGCGCATCGCCCGTTCCGGCCGCCAGCTGTGGAGCGACCAGGCTCTGTTTGGA
CAGGTCATGGGCGACCAGGAGCTGTGGCGCGAGTGGGTGCGAGAGCTGGGCGCTGCATGGAACGGAACAACTGCC
GACATGAGACACTCAAAGCTGCCCTTCAAGGTGCGCGACATTGCAGCCGCCGCCCTGCGCAACAAGACGTTTGAC
TTTGGCATTGGCCTCGACTACAACTTCACCACCATTCCGCCAACTTGCTCCGCCGAAGAAGATGGCTTCTTTGTC
CGCCTGGATGATTCCACCGCCGCCCAGCAGCAAAGCACAAAGGCCGGTGTTCCTGGCCATGTGCGCTTTCACGGT
CTTCCCGCCGACTTGAAGCGCGCTGGCCGTTTCGATGCCGCTCTCGCCACCGTTCCCTGGGGCGACGTGCCGCTC
TACACCGACTTTTTCTTTGGCACCACCCCCGTCGGCATCCACCATAATGCCTATGTCGATAACCTCAAGCCCTGG
CGTATCAGTAATTGGTGGCACATGATGTGGTTTCATCCGCATCTACGACGCCTTGTTGAGCGCAATCTGCGTCAA
GGGCCAACCATGATGGCAAAGGTGGCCCACCCCCATGACTCCACCGCACCAGACTTGGAGTACTGGCGAGACGAC
AACAAGTTTGTCACTGTTTTTAAGCCAGCCACTCCGGGAGAGGGTTTACACATGGCCCTTGACTGGGACGGGGTA
TGTCAAAAGGGCCCCAAGCCATGGCACCAAGAGGTTTTTGGAGACGGCATGGGGCCACTGCTGCCTTGA
Gene >OphauG2|7469
ATGCCCGCCGACTCGCCCCATGCCAACCTGTGCAAATGCATCCTGTCCGCCGTGGCTCTCGGCTACCCAGCGCCC
ACTCTGCTGAATTGGCATGGCGAGTTTAACCGCCCGGAATGGCATCTTGCAGGAAGCCACATTGCCAAGCTCGAG
AGCCTGTTGGCTGTCATCCACGACCTGCTCGCTCGCTTGGACGAGACTCGGGCCAGCCAGCACGACTTGGTCATG
CTGGTTGATGCATACGATGTTTGGTTCCAGCTGCCGCCCTCGGTCCTCATTGAGCGCTACCATGAACTGAATCGC
CAAGCCAACGACCGCATCCGCATGCAGTGGCAGGCCTTCGCTCCAGGCTTTCCCCTTGGGCCTCCTCGCCAATCC
ATCGTCGTCACAAGCGCCAAGGATTGCCATCCTGGCAAGGATTCAGGCACTGATCCGAGCTACGCCCATTGGCCC
CCGTCGCCCATGCCAGACGACCTCTATGGCCCGCAAACAGATGCCCTGCTGGCCATTCTCGACCCAGCTCGGCGC
TTTCGCAAAGTCCGCCCACGATGCGTCAACAGCGGCCTCATCATGGGCCCCATGGCCGCTCTCCGCCATGCTCTA
CAGCGCTGCGCTCAAAAGGTCGAGCGCATCGCCCGTTCCGGCCGCCAGCTGTGGAGCGACCAGGCTCTGTTTGGA
CAGGTCATGGGCGACCAGGAGCTGTGGCGCGAGTGGGTGCGAGAGCTGGGCGCTGCATGGAACGGAACAACTGCC
GACATGAGACACTCAAAGCTGCCCTTCAAGGTGCGCGACATTGCAGCCGCCGCCCTGCGCAACAAGACGTTTGAC
TTTGGCATTGGCCTCGACTACAACTTCACCACCATTCCGCCAACTTGCTCCGCCGAAGAAGATGGCTTCTTTGTC
CGCCTGGATGATTCCACCGCCGCCCAGCAGCAAAGCACAAAGGCCGGTGTTCCTGGCCATGTGCGCTTTCACGGT
CTTCCCGCCGACTTGAAGCGCGCTGGCCGTTTCGATGCCGCTCTCGCCACCGTTCCCTGGGGCGACGTGCCGCTC
TACACCGACTTTTTCTTTGGCACCACCCCCGTCGGCATCCACCATAATGCCTATGTCGATAACCTCAAGCCCTGG
CGTATCAGTAATTGGTGGCACATGATGTGGTTTCATCCGCATCTACGACGCCTTGTTGAGCGCAATCTGCGTCAA
GGGCCAACCATGATGGCAAAGGTGGCCCACCCCCATGACTCCACCGCACCAGACTTGGAGTACTGGCGAGACGAC
AACAAGTTTGTCACTGTTTTTAAGCCAGCCACTCCGGGAGAGGGTTTACACATGGCCCTTGACTGGGACGGGGTA
TGTCAAAAGGGCCCCAAGCCATGGCACCAAGAGGTTTTTGGAGACGGCATGGGGCCACTGCTGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail