Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7468
Gene name
LocationContig_875:1050..2532
Strand-
Gene length (bp)1482
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.7E-27 43 182
PF08031 BBE Berberine and berberine like 5.9E-11 439 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 21 483 4.0E-18
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 29 484 4.0E-16
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 36 483 5.0E-16
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 38 225 1.0E-15
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 42 240 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 21 483 4.0E-18
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 29 484 4.0E-16
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 36 483 5.0E-16
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 38 225 1.0E-15
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 42 240 1.0E-15
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 42 240 3.0E-15
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 42 240 4.0E-15
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 42 240 2.0E-14
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 29 486 2.0E-14
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 42 205 3.0E-14
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 29 484 4.0E-14
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 42 240 2.0E-13
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 27 205 5.0E-13
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 3 205 2.0E-12
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 43 211 4.0E-12
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 29 484 4.0E-12
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 22 225 5.0E-12
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 29 247 2.0E-11
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 48 211 4.0E-11
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 43 211 4.0E-11
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 29 206 5.0E-11
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 43 205 2.0E-10
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 61 239 3.0E-10
sp|Q6FS20|ALO_CANGA D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALO1 PE=3 SV=1 22 210 2.0E-09
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 35 212 2.0E-09
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 48 211 2.0E-09
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 43 247 2.0E-09
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 43 247 2.0E-09
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 30 251 3.0E-09
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 43 237 3.0E-09
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 43 210 5.0E-09
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 12 205 2.0E-08
sp|Q0PCD7|AKNOX_STRGJ Aclacinomycin-N/aclacinomycin-A oxidase OS=Streptomyces galilaeus GN=aknOx PE=1 SV=1 42 211 2.0E-08
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 43 218 3.0E-08
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 29 178 3.0E-08
sp|Q6BZA0|ALO_DEBHA D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALO1 PE=3 SV=2 12 211 3.0E-08
sp|O29853|DLD_ARCFU D-lactate dehydrogenase (acceptor) OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dld PE=1 SV=1 18 212 3.0E-08
sp|Q6CG88|ALO_YARLI D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALO1 PE=3 SV=1 26 221 3.0E-08
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 43 225 8.0E-08
sp|Q9KX73|XYOA_STRSI Xylitol oxidase OS=Streptomyces sp. (strain IKD472 / FERM P-14339) GN=xyoA PE=1 SV=1 46 209 8.0E-08
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 42 240 1.0E-07
sp|Q796P5|YITY_BACSU Uncharacterized FAD-linked oxidoreductase YitY OS=Bacillus subtilis (strain 168) GN=yitY PE=3 SV=2 46 209 2.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 22 212 2.0E-07
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 38 218 3.0E-07
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 136 218 3.0E-07
sp|Q9ZBU1|XYOA_STRCO Probable xylitol oxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xyoA PE=1 SV=1 46 209 3.0E-07
sp|Q9T0N8|CKX1_MAIZE Cytokinin dehydrogenase 1 OS=Zea mays GN=CKX1 PE=1 SV=2 43 284 4.0E-07
sp|P9WIT3|GULDH_MYCTU L-gulono-1,4-lactone dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1771 PE=1 SV=1 43 211 4.0E-07
sp|P9WIT2|GULDH_MYCTO L-gulono-1,4-lactone dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1821 PE=3 SV=1 43 211 4.0E-07
sp|A0R607|DPRE1_MYCS2 FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE1 PE=1 SV=2 55 209 4.0E-07
sp|Q9SU56|GLDH_ARATH L-galactono-1,4-lactone dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=GLDH PE=1 SV=1 31 210 4.0E-07
sp|Q5ZAY9|CKX5_ORYSJ Cytokinin dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CKX5 PE=2 SV=1 38 191 5.0E-07
sp|P9WJF1|DPRE1_MYCTU FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dprE1 PE=1 SV=1 49 216 5.0E-07
sp|P9WJF0|DPRE1_MYCTO Probable decaprenylphosphoryl-beta-D-ribose oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dprE1 PE=3 SV=1 49 216 5.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 43 205 8.0E-07
sp|O93852|ALO_CANAL D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALO1 PE=3 SV=1 33 211 9.0E-07
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 2 218 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 5.8E-73 32 481

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3274
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7468 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01056
Ophiocordyceps camponoti-rufipedis Ophun1|6672
Ophiocordyceps kimflemingae Ophio5|2376
Ophiocordyceps subramaniannii Hirsu2|5980
Ophiocordyceps subramaniannii Hirsu2|7959

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7468
MAMSFDIAKRFRAEVPDVPSFFPGEKHFYTHTATWNMLKEHKPIGVVRPESAQQVSAVVKAARKLGIKHVAVRGG
GHSFEGLGLGGKNGALVIDMLGMNSVTSDPSKHEITAGGGTFLGTTALWAYEHGRQMAPMGTCPTVGIGGQVQCG
GYGLYTRTHGPLTDCVVSMEVVTADGEIRRVSDSENAELFFALRGSGVGSFGVITSVTLRTYNAATHVADFSVRW
KIKGNDVADILKKIQAACVAAPLCFNPMVVIWLGVVEVTGAILANSVTERDAAWDGFISSVPKPYEIRHDAVDYI
DTFRDIELSQTSAPWYDAPEEMKREGHEHSRYMKIKAGFVDGLLPDAFWDKLAALAATQPLEGVRVQLLGLNPAW
KPSPDTTSIKVRGSTWLMGMSVWLPVKEYGRHGVMVEGDGRRPWLNEAYELFYPHTVGGYIGDDDEEEGLHGRDL
HESYYGKHKERLARAKAAYDPTNLFHNHMSIAPAAGDKFKANL*
Coding >OphauG2|7468
ATGGCCATGTCCTTTGACATTGCAAAACGGTTCCGCGCAGAGGTGCCCGACGTGCCCAGCTTCTTTCCTGGAGAA
AAACACTTTTACACGCACACGGCAACATGGAACATGCTCAAGGAGCACAAGCCGATTGGAGTGGTTCGGCCCGAG
TCGGCGCAGCAGGTCAGCGCCGTGGTCAAGGCGGCTCGCAAGCTGGGCATCAAGCACGTGGCAGTGCGAGGCGGC
GGGCACTCGTTTGAAGGGCTGGGGCTGGGCGGCAAGAATGGGGCGCTGGTCATCGACATGCTGGGCATGAACTCG
GTCACGTCGGACCCCAGCAAGCACGAGATTACGGCTGGGGGCGGGACGTTTCTGGGGACCACGGCGCTGTGGGCA
TATGAACACGGGCGGCAGATGGCGCCCATGGGGACGTGTCCGACAGTGGGCATTGGCGGCCAGGTGCAGTGCGGC
GGCTACGGGCTGTACACGCGCACGCACGGGCCGCTGACGGACTGCGTGGTGTCGATGGAGGTGGTGACGGCGGAC
GGGGAGATCCGGAGGGTGAGCGACAGCGAGAACGCGGAGCTGTTTTTTGCGCTGCGCGGGTCGGGCGTGGGGTCG
TTTGGCGTGATTACATCGGTGACGCTGCGGACGTACAACGCGGCGACACATGTGGCCGACTTTTCGGTGCGGTGG
AAGATTAAAGGCAACGACGTGGCGGACATTCTCAAGAAGATCCAGGCGGCCTGCGTGGCGGCGCCGCTGTGCTTC
AACCCCATGGTGGTCATCTGGCTGGGCGTGGTCGAGGTGACGGGGGCGATTCTGGCCAACTCGGTAACAGAGCGC
GACGCGGCGTGGGACGGCTTCATCTCGTCGGTGCCCAAGCCGTACGAAATCCGACACGACGCCGTCGACTACATC
GACACGTTCCGCGACATTGAGCTATCCCAGACGTCGGCGCCGTGGTACGACGCGCCCGAGGAGATGAAGCGCGAG
GGCCACGAACACTCGCGCTACATGAAGATCAAGGCCGGCTTTGTCGACGGGCTGCTCCCCGACGCCTTCTGGGAC
AAGCTGGCCGCGCTGGCGGCGACGCAGCCGCTCGAGGGCGTGCGCGTGCAGCTGCTGGGCCTCAACCCGGCCTGG
AAGCCGAGCCCCGACACCACCTCCATCAAGGTCCGCGGCAGCACCTGGCTGATGGGCATGTCGGTGTGGCTGCCC
GTCAAGGAGTACGGGCGCCACGGCGTCATGGTCGAGGGCGACGGGCGGCGGCCGTGGCTGAATGAGGCGTACGAG
CTGTTTTACCCGCACACCGTGGGCGGGTACATTGGCGACGACGACGAGGAGGAGGGGCTGCATGGGCGGGATTTG
CACGAGAGCTACTATGGGAAGCACAAGGAGCGCTTGGCGCGCGCAAAGGCGGCGTATGACCCGACGAATCTGTTT
CACAATCACATGTCGATTGCGCCGGCTGCAGGCGACAAGTTCAAGGCCAATCTGTGA
Transcript >OphauG2|7468
ATGGCCATGTCCTTTGACATTGCAAAACGGTTCCGCGCAGAGGTGCCCGACGTGCCCAGCTTCTTTCCTGGAGAA
AAACACTTTTACACGCACACGGCAACATGGAACATGCTCAAGGAGCACAAGCCGATTGGAGTGGTTCGGCCCGAG
TCGGCGCAGCAGGTCAGCGCCGTGGTCAAGGCGGCTCGCAAGCTGGGCATCAAGCACGTGGCAGTGCGAGGCGGC
GGGCACTCGTTTGAAGGGCTGGGGCTGGGCGGCAAGAATGGGGCGCTGGTCATCGACATGCTGGGCATGAACTCG
GTCACGTCGGACCCCAGCAAGCACGAGATTACGGCTGGGGGCGGGACGTTTCTGGGGACCACGGCGCTGTGGGCA
TATGAACACGGGCGGCAGATGGCGCCCATGGGGACGTGTCCGACAGTGGGCATTGGCGGCCAGGTGCAGTGCGGC
GGCTACGGGCTGTACACGCGCACGCACGGGCCGCTGACGGACTGCGTGGTGTCGATGGAGGTGGTGACGGCGGAC
GGGGAGATCCGGAGGGTGAGCGACAGCGAGAACGCGGAGCTGTTTTTTGCGCTGCGCGGGTCGGGCGTGGGGTCG
TTTGGCGTGATTACATCGGTGACGCTGCGGACGTACAACGCGGCGACACATGTGGCCGACTTTTCGGTGCGGTGG
AAGATTAAAGGCAACGACGTGGCGGACATTCTCAAGAAGATCCAGGCGGCCTGCGTGGCGGCGCCGCTGTGCTTC
AACCCCATGGTGGTCATCTGGCTGGGCGTGGTCGAGGTGACGGGGGCGATTCTGGCCAACTCGGTAACAGAGCGC
GACGCGGCGTGGGACGGCTTCATCTCGTCGGTGCCCAAGCCGTACGAAATCCGACACGACGCCGTCGACTACATC
GACACGTTCCGCGACATTGAGCTATCCCAGACGTCGGCGCCGTGGTACGACGCGCCCGAGGAGATGAAGCGCGAG
GGCCACGAACACTCGCGCTACATGAAGATCAAGGCCGGCTTTGTCGACGGGCTGCTCCCCGACGCCTTCTGGGAC
AAGCTGGCCGCGCTGGCGGCGACGCAGCCGCTCGAGGGCGTGCGCGTGCAGCTGCTGGGCCTCAACCCGGCCTGG
AAGCCGAGCCCCGACACCACCTCCATCAAGGTCCGCGGCAGCACCTGGCTGATGGGCATGTCGGTGTGGCTGCCC
GTCAAGGAGTACGGGCGCCACGGCGTCATGGTCGAGGGCGACGGGCGGCGGCCGTGGCTGAATGAGGCGTACGAG
CTGTTTTACCCGCACACCGTGGGCGGGTACATTGGCGACGACGACGAGGAGGAGGGGCTGCATGGGCGGGATTTG
CACGAGAGCTACTATGGGAAGCACAAGGAGCGCTTGGCGCGCGCAAAGGCGGCGTATGACCCGACGAATCTGTTT
CACAATCACATGTCGATTGCGCCGGCTGCAGGCGACAAGTTCAAGGCCAATCTGTGA
Gene >OphauG2|7468
ATGGCCATGTCCTTTGACATTGCAAAACGGTTCCGCGCAGAGGTGCCCGACGTGCCCAGCTTCTTTCCTGGAGAA
AAACACTTTTACACGCACACGGCAACATGGAACATGCTCAAGGAGCACAAGCCGATTGGAGTGGTTCGGCCCGAG
TCGGCGCAGCAGGTCAGCGCCGTGGTCAAGGCGGCTCGCAAGCTGGGCATCAAGCACGTGGCAGTGCGAGGCGGC
GGGCACTCGTTTGAAGGGCTGGGGCTGGGCGGCAAGAATGGGGCGCTGGTCATCGACATGCTGGGCATGAACTCG
GTCACGTCGGACCCCAGCAAGCACGAGATTACGGCTGGGGGCGGGACGTTTCTGGGGACCACGGCGCTGTGGGCA
TATGAACACGGGCGGCAGATGGCGCCCATGGGGACGTGTCCGACAGTGGGCATTGGCGGCCAGGTGCAGTGCGGC
GGCTACGGGCTGTACACGCGCACGCACGGGCCGCTGACGGACTGCGTGGTGTCGATGGAGGTGGTGACGGCGGAC
GGGGAGATCCGGAGGGTGAGCGACAGCGAGAACGCGGAGCTGTTTTTTGCGCTGCGCGGGTCGGGCGTGGGGTCG
TTTGGCGTGATTACATCGGTGACGCTGCGGACGTACAACGCGGCGACACATGTGGCCGACTTTTCGGTGCGGTGG
AAGATTAAAGGCAACGACGTGGCGGACATTCTCAAGAAGATCCAGGCGGCCTGCGTGGCGGCGCCGCTGTGCTTC
AACCCCATGGTGGTCATCTGGCTGGGCGTGGTCGAGGTGACGGGGGCGATTCTGGCCAACTCGGTAACAGAGCGC
GACGCGGCGTGGGACGGCTTCATCTCGTCGGTGCCCAAGCCGTACGAAATCCGACACGACGCCGTCGACTACATC
GACACGTTCCGCGACATTGAGCTATCCCAGACGTCGGCGCCGTGGTACGACGCGCCCGAGGAGATGAAGCGCGAG
GGCCACGAACACTCGCGCTACATGAAGATCAAGGCCGGCTTTGTCGACGGGCTGCTCCCCGACGCCTTCTGGGAC
AAGCTGGCCGCGCTGGCGGCGACGCAGCCGCTCGAGGGCGTGCGCGTGCAGCTGCTGGGCCTCAACCCGGCCTGG
AAGCCGAGCCCCGACACCACCTCCATCAAGGTCCGCGGCAGCACCTGGCTGATGGGCATGTCGGTGTGGCTGCCC
GTCAAGGAGTACGGGCGCCACGGCGTCATGGTCGAGGGCGACGGGCGGCGGCCGTGGCTGAATGAGGCGTACGAG
CTGTTTTACCCGCACACCGTGGGCGGGTACATTGGCGACGACGACGAGGAGGAGGGGCTGCATGGGCGGGATTTG
CACGAGAGCTACTATGGGAAGCACAAGGAGCGCTTGGCGCGCGCAAAGGCGGCGTATGACCCGACGAATCTGTTT
CACAATCACATGTCGATTGCGCCGGCTGCAGGCGACAAGTTCAAGGCCAATCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail