Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7460
Gene name
LocationContig_870:5403..7866
Strand+
Gene length (bp)2463
Transcript length (bp)2463
Coding sequence length (bp)2463
Protein length (aa) 821

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01902 Diphthami_syn_2 Diphthamide synthase 8.9E-22 7 243
PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP 5.1E-07 361 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ7|DPH6_SCHPO Diphthine--ammonia ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug71 PE=1 SV=1 6 569 3.0E-75
sp|Q12429|DPH6_YEAST Diphthine--ammonia ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH6 PE=1 SV=1 6 551 1.0E-55
sp|Q5M9F5|DPH6_RAT Diphthine--ammonia ligase OS=Rattus norvegicus GN=Dph6 PE=2 SV=1 6 281 9.0E-45
sp|Q7L8W6|DPH6_HUMAN Diphthine--ammonia ligase OS=Homo sapiens GN=DPH6 PE=1 SV=3 6 269 9.0E-45
sp|A2RV01|DPH6_DANRE Diphthine--ammonia ligase OS=Danio rerio GN=dph6 PE=2 SV=1 6 271 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ7|DPH6_SCHPO Diphthine--ammonia ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug71 PE=1 SV=1 6 569 3.0E-75
sp|Q12429|DPH6_YEAST Diphthine--ammonia ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH6 PE=1 SV=1 6 551 1.0E-55
sp|Q5M9F5|DPH6_RAT Diphthine--ammonia ligase OS=Rattus norvegicus GN=Dph6 PE=2 SV=1 6 281 9.0E-45
sp|Q7L8W6|DPH6_HUMAN Diphthine--ammonia ligase OS=Homo sapiens GN=DPH6 PE=1 SV=3 6 269 9.0E-45
sp|A2RV01|DPH6_DANRE Diphthine--ammonia ligase OS=Danio rerio GN=dph6 PE=2 SV=1 6 271 1.0E-43
sp|Q9CQ28|DPH6_MOUSE Diphthine--ammonia ligase OS=Mus musculus GN=Dph6 PE=1 SV=1 6 278 2.0E-43
sp|Q2HJF5|DPH6_BOVIN Diphthine--ammonia ligase OS=Bos taurus GN=DPH6 PE=2 SV=1 6 269 6.0E-43
sp|Q57990|Y570_METJA Uncharacterized protein MJ0570 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0570 PE=4 SV=1 6 270 2.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2496
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7460 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7630
Ophiocordyceps camponoti-floridani Ophcf2|00437
Ophiocordyceps camponoti-rufipedis Ophun1|4885
Ophiocordyceps kimflemingae Ophio5|7658
Ophiocordyceps subramaniannii Hirsu2|3614

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7460
MAPQGLNVIALISGGKDSFYSALHCLHQGHGIVALANVFPSEAVGGEDEADVNSFMYQTVGHEVVGLYAGATGVP
VYRQAIGGQAVQAQRDYDYDGQDGDETEAMTRLLGRIVERHPEANAVSSGAILSTYQRTRVESVAARLGLVALAY
LWRYPGQGDDGLGLLRAMGAARLEARIIKVASAGLDERHLWEAVTTQRGAQSVSRALGRFGPSPGAALGEGGEFE
TLVVNGPKALFRRRIHVPDDGRTVVSEGGGCWWLKLRGARLEDKEEEEEEEEEGISLAEPALVDGRFALVASLLQ
HGEHEQHGEHEQHGEHEQHEEQHEEQLEEQLEEQLGQLLASPMPLHWAFVADTTTPTPCPSPADQTRRIMLQMKH
RLAAHGRQACDITSTLVMLRDMTDFAAVNAEYATLFTRANPPARVTIACGHGLPAGISVVLYATLPSRPGPRDGL
HVQSRSYWAPANIGPYSQAISVALLTGPCCADDEDSGEGSEDNNKDNAKAMDPRLARQARHTSQATEARAVHVAG
QIGLVPASMTLPQDEALQLVLALQHLWRIGVATQVQCWTSGVAYFARCPCLRRMHRQVLLAAQAWRLLHLRSHDD
DDXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDNDSDSDRLAPLLPDWSALAANTQASMAPFFVAEVDSLPRGAQ
VEWHAHTGISHADAASIRIVSPVAAAATGWSAWHLVVRAAHTAVVYTTLAHPRRSFTPRQLRLAVAKAYAAALDA
PLLNLPQRTQPALALPPARLCYVDAQMTARPWAQWQRERLAVVPCRSLWTARGDRVGVVALCQTAWTTPP*
Coding >OphauG2|7460
ATGGCGCCCCAAGGCCTCAATGTCATTGCGCTCATCTCGGGCGGCAAGGATAGCTTCTACAGCGCGCTGCACTGC
CTGCACCAGGGCCATGGGATTGTGGCGCTGGCCAATGTGTTTCCGTCAGAGGCAGTCGGTGGGGAGGATGAGGCC
GACGTGAATAGCTTCATGTACCAGACAGTGGGCCACGAGGTGGTGGGGCTGTATGCCGGGGCAACGGGCGTCCCG
GTGTACCGGCAGGCGATTGGCGGGCAGGCGGTGCAGGCACAGCGCGACTACGACTATGACGGCCAGGATGGCGAC
GAGACCGAGGCCATGACGCGTCTGCTGGGCCGCATCGTGGAGCGGCATCCCGAGGCCAACGCCGTGTCGTCGGGC
GCCATCCTGTCCACCTACCAGCGCACGCGCGTCGAGTCGGTGGCTGCGCGTCTGGGTCTGGTGGCGCTGGCGTAT
CTGTGGAGGTATCCGGGGCAGGGCGACGATGGGCTGGGTCTGCTGAGGGCCATGGGGGCGGCGCGGCTCGAGGCC
CGCATCATCAAGGTGGCCAGCGCAGGGCTCGACGAGCGCCATCTATGGGAGGCTGTCACGACCCAGCGGGGCGCA
CAGTCGGTCAGCAGGGCGTTGGGGCGCTTTGGGCCCAGTCCAGGCGCGGCGCTGGGAGAGGGCGGCGAGTTTGAG
ACGCTGGTTGTCAATGGGCCCAAGGCGCTGTTTAGGCGCCGCATCCATGTGCCGGACGACGGCCGGACTGTGGTG
AGCGAGGGGGGCGGATGTTGGTGGCTCAAGCTGCGCGGCGCACGTCTGGAGGACAAGGAGGAGGAGGAGGAGGAG
GAGGAGGAGGGGATCAGTCTGGCGGAGCCTGCGCTTGTTGATGGGCGTTTTGCGCTTGTTGCATCTCTTTTGCAG
CATGGGGAGCACGAGCAGCATGGGGAGCACGAGCAGCATGGGGAGCACGAGCAGCATGAGGAGCAGCATGAGGAG
CAGCTTGAGGAGCAGCTTGAGGAGCAGCTTGGGCAACTCTTGGCCTCTCCAATGCCGCTACACTGGGCCTTTGTC
GCCGACACGACGACACCCACGCCCTGCCCGTCGCCCGCAGACCAGACGCGACGCATCATGCTCCAGATGAAGCAC
AGACTGGCGGCTCACGGCCGGCAAGCCTGCGACATTACAAGCACCCTGGTGATGCTACGCGACATGACCGACTTT
GCTGCCGTCAACGCCGAGTATGCCACGCTCTTTACCCGCGCCAACCCGCCGGCACGCGTCACCATTGCCTGCGGG
CATGGGCTGCCGGCGGGCATCAGCGTGGTCCTTTATGCCACGCTGCCCAGCAGACCAGGCCCTCGCGACGGGCTT
CACGTGCAGTCACGATCCTACTGGGCTCCGGCAAACATTGGGCCCTACAGCCAGGCAATTTCCGTGGCGCTGCTG
ACGGGTCCCTGCTGCGCTGACGACGAGGACAGCGGCGAGGGCAGCGAGGACAACAACAAGGACAATGCCAAGGCA
ATGGACCCAAGGCTGGCCAGGCAGGCCAGGCATACAAGCCAGGCCACAGAGGCGCGAGCCGTCCACGTTGCCGGA
CAGATTGGCCTGGTGCCTGCGTCCATGACGCTGCCCCAAGACGAGGCGCTGCAGCTGGTCCTCGCCCTGCAACAC
CTGTGGCGCATCGGCGTCGCGACCCAGGTGCAGTGCTGGACCAGCGGCGTGGCCTATTTTGCCCGCTGTCCATGT
CTACGACGAATGCATCGCCAGGTCCTGCTGGCTGCACAAGCGTGGAGGCTGTTGCACCTGCGCAGCCACGACGAC
GACGACGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNACGACGACGACAACGACAGCGACAGCGACAGGCTGGCGCCTCTTCTCCCCGACTGGTCTGCC
CTTGCGGCCAATACTCAAGCGTCCATGGCGCCCTTTTTCGTTGCCGAGGTGGACAGTCTGCCGCGCGGAGCCCAG
GTCGAATGGCATGCTCACACGGGCATCAGCCACGCCGACGCCGCCAGCATCCGCATCGTCAGCCCCGTCGCCGCC
GCCGCCACGGGCTGGAGCGCATGGCACCTCGTGGTGCGGGCGGCACACACGGCCGTTGTCTACACCACGCTGGCG
CACCCGCGACGCAGCTTCACGCCTCGCCAGTTGCGCCTGGCCGTCGCCAAAGCATACGCCGCCGCCCTCGATGCG
CCTTTATTGAATTTACCTCAACGGACCCAACCCGCCCTGGCCTTGCCGCCAGCCCGGCTATGCTATGTCGACGCG
CAAATGACGGCACGGCCCTGGGCCCAGTGGCAGCGCGAGCGCTTGGCCGTCGTGCCCTGCCGCTCGCTGTGGACG
GCTCGCGGAGACCGCGTGGGCGTCGTGGCCCTGTGCCAAACCGCCTGGACCACCCCGCCTTGA
Transcript >OphauG2|7460
ATGGCGCCCCAAGGCCTCAATGTCATTGCGCTCATCTCGGGCGGCAAGGATAGCTTCTACAGCGCGCTGCACTGC
CTGCACCAGGGCCATGGGATTGTGGCGCTGGCCAATGTGTTTCCGTCAGAGGCAGTCGGTGGGGAGGATGAGGCC
GACGTGAATAGCTTCATGTACCAGACAGTGGGCCACGAGGTGGTGGGGCTGTATGCCGGGGCAACGGGCGTCCCG
GTGTACCGGCAGGCGATTGGCGGGCAGGCGGTGCAGGCACAGCGCGACTACGACTATGACGGCCAGGATGGCGAC
GAGACCGAGGCCATGACGCGTCTGCTGGGCCGCATCGTGGAGCGGCATCCCGAGGCCAACGCCGTGTCGTCGGGC
GCCATCCTGTCCACCTACCAGCGCACGCGCGTCGAGTCGGTGGCTGCGCGTCTGGGTCTGGTGGCGCTGGCGTAT
CTGTGGAGGTATCCGGGGCAGGGCGACGATGGGCTGGGTCTGCTGAGGGCCATGGGGGCGGCGCGGCTCGAGGCC
CGCATCATCAAGGTGGCCAGCGCAGGGCTCGACGAGCGCCATCTATGGGAGGCTGTCACGACCCAGCGGGGCGCA
CAGTCGGTCAGCAGGGCGTTGGGGCGCTTTGGGCCCAGTCCAGGCGCGGCGCTGGGAGAGGGCGGCGAGTTTGAG
ACGCTGGTTGTCAATGGGCCCAAGGCGCTGTTTAGGCGCCGCATCCATGTGCCGGACGACGGCCGGACTGTGGTG
AGCGAGGGGGGCGGATGTTGGTGGCTCAAGCTGCGCGGCGCACGTCTGGAGGACAAGGAGGAGGAGGAGGAGGAG
GAGGAGGAGGGGATCAGTCTGGCGGAGCCTGCGCTTGTTGATGGGCGTTTTGCGCTTGTTGCATCTCTTTTGCAG
CATGGGGAGCACGAGCAGCATGGGGAGCACGAGCAGCATGGGGAGCACGAGCAGCATGAGGAGCAGCATGAGGAG
CAGCTTGAGGAGCAGCTTGAGGAGCAGCTTGGGCAACTCTTGGCCTCTCCAATGCCGCTACACTGGGCCTTTGTC
GCCGACACGACGACACCCACGCCCTGCCCGTCGCCCGCAGACCAGACGCGACGCATCATGCTCCAGATGAAGCAC
AGACTGGCGGCTCACGGCCGGCAAGCCTGCGACATTACAAGCACCCTGGTGATGCTACGCGACATGACCGACTTT
GCTGCCGTCAACGCCGAGTATGCCACGCTCTTTACCCGCGCCAACCCGCCGGCACGCGTCACCATTGCCTGCGGG
CATGGGCTGCCGGCGGGCATCAGCGTGGTCCTTTATGCCACGCTGCCCAGCAGACCAGGCCCTCGCGACGGGCTT
CACGTGCAGTCACGATCCTACTGGGCTCCGGCAAACATTGGGCCCTACAGCCAGGCAATTTCCGTGGCGCTGCTG
ACGGGTCCCTGCTGCGCTGACGACGAGGACAGCGGCGAGGGCAGCGAGGACAACAACAAGGACAATGCCAAGGCA
ATGGACCCAAGGCTGGCCAGGCAGGCCAGGCATACAAGCCAGGCCACAGAGGCGCGAGCCGTCCACGTTGCCGGA
CAGATTGGCCTGGTGCCTGCGTCCATGACGCTGCCCCAAGACGAGGCGCTGCAGCTGGTCCTCGCCCTGCAACAC
CTGTGGCGCATCGGCGTCGCGACCCAGGTGCAGTGCTGGACCAGCGGCGTGGCCTATTTTGCCCGCTGTCCATGT
CTACGACGAATGCATCGCCAGGTCCTGCTGGCTGCACAAGCGTGGAGGCTGTTGCACCTGCGCAGCCACGACGAC
GACGACGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNACGACGACGACAACGACAGCGACAGCGACAGGCTGGCGCCTCTTCTCCCCGACTGGTCTGCC
CTTGCGGCCAATACTCAAGCGTCCATGGCGCCCTTTTTCGTTGCCGAGGTGGACAGTCTGCCGCGCGGAGCCCAG
GTCGAATGGCATGCTCACACGGGCATCAGCCACGCCGACGCCGCCAGCATCCGCATCGTCAGCCCCGTCGCCGCC
GCCGCCACGGGCTGGAGCGCATGGCACCTCGTGGTGCGGGCGGCACACACGGCCGTTGTCTACACCACGCTGGCG
CACCCGCGACGCAGCTTCACGCCTCGCCAGTTGCGCCTGGCCGTCGCCAAAGCATACGCCGCCGCCCTCGATGCG
CCTTTATTGAATTTACCTCAACGGACCCAACCCGCCCTGGCCTTGCCGCCAGCCCGGCTATGCTATGTCGACGCG
CAAATGACGGCACGGCCCTGGGCCCAGTGGCAGCGCGAGCGCTTGGCCGTCGTGCCCTGCCGCTCGCTGTGGACG
GCTCGCGGAGACCGCGTGGGCGTCGTGGCCCTGTGCCAAACCGCCTGGACCACCCCGCCTTGA
Gene >OphauG2|7460
ATGGCGCCCCAAGGCCTCAATGTCATTGCGCTCATCTCGGGCGGCAAGGATAGCTTCTACAGCGCGCTGCACTGC
CTGCACCAGGGCCATGGGATTGTGGCGCTGGCCAATGTGTTTCCGTCAGAGGCAGTCGGTGGGGAGGATGAGGCC
GACGTGAATAGCTTCATGTACCAGACAGTGGGCCACGAGGTGGTGGGGCTGTATGCCGGGGCAACGGGCGTCCCG
GTGTACCGGCAGGCGATTGGCGGGCAGGCGGTGCAGGCACAGCGCGACTACGACTATGACGGCCAGGATGGCGAC
GAGACCGAGGCCATGACGCGTCTGCTGGGCCGCATCGTGGAGCGGCATCCCGAGGCCAACGCCGTGTCGTCGGGC
GCCATCCTGTCCACCTACCAGCGCACGCGCGTCGAGTCGGTGGCTGCGCGTCTGGGTCTGGTGGCGCTGGCGTAT
CTGTGGAGGTATCCGGGGCAGGGCGACGATGGGCTGGGTCTGCTGAGGGCCATGGGGGCGGCGCGGCTCGAGGCC
CGCATCATCAAGGTGGCCAGCGCAGGGCTCGACGAGCGCCATCTATGGGAGGCTGTCACGACCCAGCGGGGCGCA
CAGTCGGTCAGCAGGGCGTTGGGGCGCTTTGGGCCCAGTCCAGGCGCGGCGCTGGGAGAGGGCGGCGAGTTTGAG
ACGCTGGTTGTCAATGGGCCCAAGGCGCTGTTTAGGCGCCGCATCCATGTGCCGGACGACGGCCGGACTGTGGTG
AGCGAGGGGGGCGGATGTTGGTGGCTCAAGCTGCGCGGCGCACGTCTGGAGGACAAGGAGGAGGAGGAGGAGGAG
GAGGAGGAGGGGATCAGTCTGGCGGAGCCTGCGCTTGTTGATGGGCGTTTTGCGCTTGTTGCATCTCTTTTGCAG
CATGGGGAGCACGAGCAGCATGGGGAGCACGAGCAGCATGGGGAGCACGAGCAGCATGAGGAGCAGCATGAGGAG
CAGCTTGAGGAGCAGCTTGAGGAGCAGCTTGGGCAACTCTTGGCCTCTCCAATGCCGCTACACTGGGCCTTTGTC
GCCGACACGACGACACCCACGCCCTGCCCGTCGCCCGCAGACCAGACGCGACGCATCATGCTCCAGATGAAGCAC
AGACTGGCGGCTCACGGCCGGCAAGCCTGCGACATTACAAGCACCCTGGTGATGCTACGCGACATGACCGACTTT
GCTGCCGTCAACGCCGAGTATGCCACGCTCTTTACCCGCGCCAACCCGCCGGCACGCGTCACCATTGCCTGCGGG
CATGGGCTGCCGGCGGGCATCAGCGTGGTCCTTTATGCCACGCTGCCCAGCAGACCAGGCCCTCGCGACGGGCTT
CACGTGCAGTCACGATCCTACTGGGCTCCGGCAAACATTGGGCCCTACAGCCAGGCAATTTCCGTGGCGCTGCTG
ACGGGTCCCTGCTGCGCTGACGACGAGGACAGCGGCGAGGGCAGCGAGGACAACAACAAGGACAATGCCAAGGCA
ATGGACCCAAGGCTGGCCAGGCAGGCCAGGCATACAAGCCAGGCCACAGAGGCGCGAGCCGTCCACGTTGCCGGA
CAGATTGGCCTGGTGCCTGCGTCCATGACGCTGCCCCAAGACGAGGCGCTGCAGCTGGTCCTCGCCCTGCAACAC
CTGTGGCGCATCGGCGTCGCGACCCAGGTGCAGTGCTGGACCAGCGGCGTGGCCTATTTTGCCCGCTGTCCATGT
CTACGACGAATGCATCGCCAGGTCCTGCTGGCTGCACAAGCGTGGAGGCTGTTGCACCTGCGCAGCCACGACGAC
GACGACGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNACGACGACGACAACGACAGCGACAGCGACAGGCTGGCGCCTCTTCTCCCCGACTGGTCTGCC
CTTGCGGCCAATACTCAAGCGTCCATGGCGCCCTTTTTCGTTGCCGAGGTGGACAGTCTGCCGCGCGGAGCCCAG
GTCGAATGGCATGCTCACACGGGCATCAGCCACGCCGACGCCGCCAGCATCCGCATCGTCAGCCCCGTCGCCGCC
GCCGCCACGGGCTGGAGCGCATGGCACCTCGTGGTGCGGGCGGCACACACGGCCGTTGTCTACACCACGCTGGCG
CACCCGCGACGCAGCTTCACGCCTCGCCAGTTGCGCCTGGCCGTCGCCAAAGCATACGCCGCCGCCCTCGATGCG
CCTTTATTGAATTTACCTCAACGGACCCAACCCGCCCTGGCCTTGCCGCCAGCCCGGCTATGCTATGTCGACGCG
CAAATGACGGCACGGCCCTGGGCCCAGTGGCAGCGCGAGCGCTTGGCCGTCGTGCCCTGCCGCTCGCTGTGGACG
GCTCGCGGAGACCGCGTGGGCGTCGTGGCCCTGTGCCAAACCGCCTGGACCACCCCGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail