Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7457
Gene name
LocationContig_87:30294..31218
Strand-
Gene length (bp)924
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01997 Translin Translin family 1.1E-54 40 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JHB5|TSNAX_RAT Translin-associated protein X OS=Rattus norvegicus GN=Tsnax PE=1 SV=1 19 254 1.0E-21
sp|Q9QZE7|TSNAX_MOUSE Translin-associated protein X OS=Mus musculus GN=Tsnax PE=1 SV=1 11 254 1.0E-21
sp|Q5RC21|TSNAX_PONAB Translin-associated protein X OS=Pongo abelii GN=TSNAX PE=2 SV=1 20 254 4.0E-21
sp|Q99598|TSNAX_HUMAN Translin-associated protein X OS=Homo sapiens GN=TSNAX PE=1 SV=1 20 254 4.0E-21
sp|Q4R599|TSNAX_MACFA Translin-associated protein X OS=Macaca fascicularis GN=TSNAX PE=2 SV=1 20 254 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JHB5|TSNAX_RAT Translin-associated protein X OS=Rattus norvegicus GN=Tsnax PE=1 SV=1 19 254 1.0E-21
sp|Q9QZE7|TSNAX_MOUSE Translin-associated protein X OS=Mus musculus GN=Tsnax PE=1 SV=1 11 254 1.0E-21
sp|Q5RC21|TSNAX_PONAB Translin-associated protein X OS=Pongo abelii GN=TSNAX PE=2 SV=1 20 254 4.0E-21
sp|Q99598|TSNAX_HUMAN Translin-associated protein X OS=Homo sapiens GN=TSNAX PE=1 SV=1 20 254 4.0E-21
sp|Q4R599|TSNAX_MACFA Translin-associated protein X OS=Macaca fascicularis GN=TSNAX PE=2 SV=1 20 254 5.0E-21
sp|O74955|TSNAX_SCHPO Translin-associated protein X homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.09c PE=3 SV=1 28 246 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003677 DNA binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7457
MVGLKRDREGNSRPVIPDASSGPFGDMFCSFRDELDQHYDRKERIVKASRDVTAHAKKIIFALQRVKQLNCDFPA
STQKDVDAHMSSIAKLLASIAPDLGPLNRHRYASQLRCLEELVEALSFAHYLRHQSIVSAPELQAAMPVMPGGTD
TPLALSEHDYLFGLFDLFGELMRFATVRRDKVLPARKEGEQTHRPLLRDMQQLACAFELLPPQAGKDFGSKMEVM
RQSVCKVEMLGYGLVVRGSERPNDWVPDMRDQASRPASPV*
Coding >OphauG2|7457
ATGGTAGGCCTCAAGCGGGACAGAGAGGGCAATTCGCGCCCTGTAATACCGGACGCGTCAAGCGGGCCGTTTGGC
GACATGTTTTGCAGCTTCCGCGACGAGCTGGACCAGCATTATGATCGCAAGGAGCGAATTGTCAAGGCCAGCCGC
GATGTGACGGCTCATGCCAAGAAGATTATTTTTGCCTTGCAACGAGTCAAGCAGCTTAATTGCGACTTTCCTGCC
TCGACGCAAAAGGATGTTGATGCGCACATGTCTTCGATTGCCAAGCTGCTCGCATCAATTGCTCCCGACCTTGGT
CCGCTAAATCGCCATCGCTATGCTTCGCAGCTGCGGTGCTTGGAAGAGCTTGTTGAAGCTCTTTCCTTTGCACAC
TATCTGCGCCACCAGTCTATCGTTTCTGCGCCCGAGCTTCAGGCCGCGATGCCTGTAATGCCAGGGGGAACTGAC
ACGCCATTGGCGCTGTCTGAGCACGACTATCTCTTTGGTCTTTTTGACTTGTTTGGCGAGCTGATGCGCTTTGCC
ACTGTCAGACGAGACAAGGTGCTGCCAGCAAGAAAGGAGGGGGAGCAGACACATCGCCCGCTGCTGCGGGACATG
CAGCAGCTTGCATGTGCGTTTGAACTACTACCGCCTCAAGCTGGCAAAGACTTTGGCTCCAAAATGGAAGTTATG
AGGCAGAGCGTGTGCAAGGTAGAGATGCTTGGCTATGGCCTCGTTGTCAGAGGTAGCGAACGGCCAAATGACTGG
GTGCCGGATATGAGGGACCAGGCCTCTAGGCCGGCGTCGCCCGTGTAG
Transcript >OphauG2|7457
ATGGTAGGCCTCAAGCGGGACAGAGAGGGCAATTCGCGCCCTGTAATACCGGACGCGTCAAGCGGGCCGTTTGGC
GACATGTTTTGCAGCTTCCGCGACGAGCTGGACCAGCATTATGATCGCAAGGAGCGAATTGTCAAGGCCAGCCGC
GATGTGACGGCTCATGCCAAGAAGATTATTTTTGCCTTGCAACGAGTCAAGCAGCTTAATTGCGACTTTCCTGCC
TCGACGCAAAAGGATGTTGATGCGCACATGTCTTCGATTGCCAAGCTGCTCGCATCAATTGCTCCCGACCTTGGT
CCGCTAAATCGCCATCGCTATGCTTCGCAGCTGCGGTGCTTGGAAGAGCTTGTTGAAGCTCTTTCCTTTGCACAC
TATCTGCGCCACCAGTCTATCGTTTCTGCGCCCGAGCTTCAGGCCGCGATGCCTGTAATGCCAGGGGGAACTGAC
ACGCCATTGGCGCTGTCTGAGCACGACTATCTCTTTGGTCTTTTTGACTTGTTTGGCGAGCTGATGCGCTTTGCC
ACTGTCAGACGAGACAAGGTGCTGCCAGCAAGAAAGGAGGGGGAGCAGACACATCGCCCGCTGCTGCGGGACATG
CAGCAGCTTGCATGTGCGTTTGAACTACTACCGCCTCAAGCTGGCAAAGACTTTGGCTCCAAAATGGAAGTTATG
AGGCAGAGCGTGTGCAAGGTAGAGATGCTTGGCTATGGCCTCGTTGTCAGAGGTAGCGAACGGCCAAATGACTGG
GTGCCGGATATGAGGGACCAGGCCTCTAGGCCGGCGTCGCCCGTGTAG
Gene >OphauG2|7457
ATGGTAGGCCTCAAGCGGGACAGAGAGGGCAATTCGCGCCCTGTAATACCGGACGCGTCAAGCGGGCCGTTTGGC
GACATGTTTTGCAGCTTCCGCGACGAGCTGGACCAGCATTATGATCGCAAGGAGCGAATTGTCAAGGCCAGCCGC
GATGTGACGGCTCATGCCAAGAAGATGTGCCTCTCTCTGTCTTGATTTGCTGCATGTGCTTGGCCTTGGACTGAC
CATGATGGTAGTATTTTTGCCTTGCAACGGTAGTAGCTGTCCTGCTGGAAATGTGGGCTGGGGTAGCTTGGACTG
AATATGGATTCACTCGATAGAGTCAAGCAGCTTAATTGCGACTTTCCTGCCTCGACGCAAAAGGATGTTGATGCG
CACATGTCTTCGATTGCCAAGCTGCTCGCATCAATTGCTCCCGACCTTGGTCCGCTAAATCGCCATCGCTATGCT
TCGCAGCTGCGGTGCTTGGAAGAGCTTGTTGAAGCTCTTTCCTTTGCACACTATCTGCGCCACCAGTCTATCGTT
TCTGCGCCCGAGCTTCAGGCCGCGATGCCTGTAATGCCAGGGGGAACTGACACGCCATTGGCGCTGTCTGAGCAC
GACTATCTCTTTGGTCTTTTTGACTTGTTTGGCGAGCTGATGCGCTTTGCCACTGTCAGACGAGACAAGGTGCTG
CCAGCAAGAAAGGAGGGGGAGCAGACACATCGCCCGCTGCTGCGGGACATGCAGCAGCTTGCATGTGCGTTTGAA
CTACTACCGCCTCAAGCTGGCAAAGACTTTGGCTCCAAAATGGAAGTTATGAGGCAGAGCGTGTGCAAGGTAGAG
ATGCTTGGCTATGGCCTCGTTGTCAGAGGTAGCGAACGGCCAAATGACTGGGTGCCGGATATGAGGGACCAGGCC
TCTAGGCCGGCGTCGCCCGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail