Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7438
Gene name
LocationContig_868:4378..6265
Strand-
Gene length (bp)1887
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04146 YTH YT521-B-like domain 1.5E-67 365 565

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 366 429 1.0E-13
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 365 429 6.0E-13
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 366 432 2.0E-12
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 366 432 7.0E-12
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 366 432 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 366 429 1.0E-13
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 365 429 6.0E-13
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 366 432 2.0E-12
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 366 432 7.0E-12
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 366 432 9.0E-12
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 505 564 5.0E-11
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 490 567 6.0E-11
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 490 567 1.0E-10
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 490 567 1.0E-10
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 507 564 1.0E-08
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 366 428 2.0E-08
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 366 428 2.0E-08
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 366 428 2.0E-08
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 509 564 4.0E-07
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 509 564 4.0E-07
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 509 564 5.0E-07
sp|P59326|YTHD1_MOUSE YTH domain-containing family protein 1 OS=Mus musculus GN=Ythdf1 PE=1 SV=1 358 437 5.0E-07
sp|Q9BYJ9|YTHD1_HUMAN YTH domain-containing family protein 1 OS=Homo sapiens GN=YTHDF1 PE=1 SV=1 366 437 8.0E-07
sp|Q06390|MRB1_YEAST Methylated RNA-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO92 PE=1 SV=1 366 469 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup407
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7438 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7806
Ophiocordyceps camponoti-floridani Ophcf2|07380
Ophiocordyceps camponoti-rufipedis Ophun1|3210
Ophiocordyceps kimflemingae Ophio5|5140
Ophiocordyceps subramaniannii Hirsu2|2237
Ophiocordyceps subramaniannii Hirsu2|7705
Ophiocordyceps subramaniannii Hirsu2|8182
Ophiocordyceps subramaniannii Hirsu2|8426

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7438
MGDVPVHSASEAAQVSLAGVDAKQKPKQPATIASSHQAFASQLDMASQQTHQGSYQAPPLGGYRPGQYPPPPAHR
YMSPIMTQMPHMAQYGAPPMAYYMHQAPMSPYYAAGHGPPSHMPSPRHNMAYYASHVVMGQAQPGFYYQQPAHEY
SMPPQPQPMLVAADVSPRPPDAPDAPPPAHGYSCLGDSNGTGPDQGHDGHKTVRGPPRKPRQSGKQTAAGTDRCQ
RPPETYIAAAGHAIWIGNLPPNTDLMSLVHHVCKETTGLESVFLISKSNCAFANFKDDKTCLAAQQTLHDSRYET
VRLVSRLRKSTVEGVAGLTAPTGPALPPGDSTRGASPNSTSSSCLSPPAKPKASAAVVDGHAHQDRFFILKSLTL
EDLELSVQTGIWATQSHNEDTLNNAFKKYDNVYLVFSANKSGEYFGYARMTSEVNKDPEAAIEFAPKSQAASALQ
LPRAIATEATQHAPRGTIIDDSARGTIFWEAERDECDTASENASDVSSNRSCEPDQGTKTWGKPFKLEWLSVTRL
PFYRTRGLRNPWNSNREVKIARDGTELEPSVGRKLIGLFNRIQSPGLASSMMRPPVAAMHLMAPI*
Coding >OphauG2|7438
ATGGGAGACGTGCCGGTTCATTCAGCCTCCGAGGCAGCACAAGTCTCTCTTGCCGGCGTCGACGCCAAACAAAAG
CCCAAACAGCCGGCGACGATAGCCTCCAGCCACCAGGCTTTTGCGTCGCAGCTCGACATGGCCAGCCAGCAGACG
CACCAAGGCTCATACCAGGCGCCACCCCTGGGCGGCTATCGTCCAGGCCAGTATCCTCCCCCGCCCGCGCACCGC
TACATGTCGCCCATCATGACGCAGATGCCTCACATGGCCCAGTATGGGGCGCCACCAATGGCATACTACATGCAC
CAGGCGCCCATGAGCCCCTACTACGCAGCTGGCCACGGTCCGCCCTCGCACATGCCGAGCCCCAGGCACAACATG
GCCTACTACGCAAGCCATGTTGTCATGGGACAAGCCCAGCCGGGCTTTTACTACCAGCAGCCGGCCCATGAGTAT
TCCATGCCGCCACAGCCACAGCCCATGCTTGTGGCAGCTGATGTCTCCCCAAGGCCCCCTGATGCTCCAGATGCA
CCACCGCCAGCTCATGGCTATAGTTGCCTTGGTGACAGCAATGGCACAGGCCCAGATCAGGGCCATGACGGGCAC
AAGACTGTGCGAGGACCTCCTAGAAAGCCTCGTCAGAGCGGTAAGCAGACAGCGGCCGGCACAGACCGTTGCCAA
AGGCCGCCAGAGACTTACATAGCGGCTGCAGGGCACGCCATCTGGATTGGCAACCTGCCTCCCAACACGGACCTG
ATGAGTCTTGTCCACCACGTCTGCAAGGAGACCACAGGACTCGAGTCCGTCTTTCTGATTTCAAAGAGCAACTGC
GCCTTTGCCAATTTCAAAGACGACAAGACGTGTCTCGCAGCTCAGCAAACTCTGCACGATTCGAGATACGAGACG
GTCCGCCTCGTCAGCCGCTTGCGTAAAAGCACCGTCGAGGGCGTGGCTGGACTGACTGCGCCCACCGGGCCAGCC
CTTCCTCCGGGCGACTCAACACGCGGGGCTTCTCCCAATTCCACATCGAGTTCCTGTCTCAGCCCGCCCGCAAAG
CCCAAGGCCAGCGCGGCTGTCGTCGACGGCCATGCCCACCAAGACAGATTCTTCATCCTCAAAAGCTTGACCCTG
GAGGACCTCGAGTTGAGCGTGCAGACTGGCATCTGGGCTACACAGTCACACAACGAGGACACCTTGAACAATGCT
TTCAAGAAATACGACAATGTCTATCTCGTCTTCTCAGCCAATAAGTCGGGCGAATACTTTGGCTATGCGCGCATG
ACTTCCGAGGTCAACAAGGACCCAGAAGCCGCCATTGAATTCGCCCCCAAGTCGCAGGCTGCCAGTGCTCTGCAG
TTGCCCAGAGCCATCGCCACAGAAGCAACCCAGCACGCGCCCAGGGGCACAATCATTGACGACTCGGCTCGCGGC
ACCATTTTCTGGGAGGCCGAGCGTGACGAGTGCGACACGGCTTCCGAAAATGCCAGCGATGTGTCGAGCAACAGG
AGCTGCGAGCCCGATCAGGGCACAAAGACGTGGGGCAAGCCCTTTAAGCTCGAGTGGCTGTCCGTGACACGACTG
CCCTTTTACAGAACAAGAGGCCTTCGAAATCCCTGGAACTCCAACAGAGAGGTCAAGATTGCCCGAGACGGAACC
GAGTTGGAGCCGTCCGTGGGCCGCAAGCTCATTGGCCTCTTCAACCGCATCCAGAGCCCGGGGTTGGCATCGTCC
ATGATGCGTCCGCCCGTGGCTGCAATGCACCTCATGGCGCCAATCTGA
Transcript >OphauG2|7438
ATGGGAGACGTGCCGGTTCATTCAGCCTCCGAGGCAGCACAAGTCTCTCTTGCCGGCGTCGACGCCAAACAAAAG
CCCAAACAGCCGGCGACGATAGCCTCCAGCCACCAGGCTTTTGCGTCGCAGCTCGACATGGCCAGCCAGCAGACG
CACCAAGGCTCATACCAGGCGCCACCCCTGGGCGGCTATCGTCCAGGCCAGTATCCTCCCCCGCCCGCGCACCGC
TACATGTCGCCCATCATGACGCAGATGCCTCACATGGCCCAGTATGGGGCGCCACCAATGGCATACTACATGCAC
CAGGCGCCCATGAGCCCCTACTACGCAGCTGGCCACGGTCCGCCCTCGCACATGCCGAGCCCCAGGCACAACATG
GCCTACTACGCAAGCCATGTTGTCATGGGACAAGCCCAGCCGGGCTTTTACTACCAGCAGCCGGCCCATGAGTAT
TCCATGCCGCCACAGCCACAGCCCATGCTTGTGGCAGCTGATGTCTCCCCAAGGCCCCCTGATGCTCCAGATGCA
CCACCGCCAGCTCATGGCTATAGTTGCCTTGGTGACAGCAATGGCACAGGCCCAGATCAGGGCCATGACGGGCAC
AAGACTGTGCGAGGACCTCCTAGAAAGCCTCGTCAGAGCGGTAAGCAGACAGCGGCCGGCACAGACCGTTGCCAA
AGGCCGCCAGAGACTTACATAGCGGCTGCAGGGCACGCCATCTGGATTGGCAACCTGCCTCCCAACACGGACCTG
ATGAGTCTTGTCCACCACGTCTGCAAGGAGACCACAGGACTCGAGTCCGTCTTTCTGATTTCAAAGAGCAACTGC
GCCTTTGCCAATTTCAAAGACGACAAGACGTGTCTCGCAGCTCAGCAAACTCTGCACGATTCGAGATACGAGACG
GTCCGCCTCGTCAGCCGCTTGCGTAAAAGCACCGTCGAGGGCGTGGCTGGACTGACTGCGCCCACCGGGCCAGCC
CTTCCTCCGGGCGACTCAACACGCGGGGCTTCTCCCAATTCCACATCGAGTTCCTGTCTCAGCCCGCCCGCAAAG
CCCAAGGCCAGCGCGGCTGTCGTCGACGGCCATGCCCACCAAGACAGATTCTTCATCCTCAAAAGCTTGACCCTG
GAGGACCTCGAGTTGAGCGTGCAGACTGGCATCTGGGCTACACAGTCACACAACGAGGACACCTTGAACAATGCT
TTCAAGAAATACGACAATGTCTATCTCGTCTTCTCAGCCAATAAGTCGGGCGAATACTTTGGCTATGCGCGCATG
ACTTCCGAGGTCAACAAGGACCCAGAAGCCGCCATTGAATTCGCCCCCAAGTCGCAGGCTGCCAGTGCTCTGCAG
TTGCCCAGAGCCATCGCCACAGAAGCAACCCAGCACGCGCCCAGGGGCACAATCATTGACGACTCGGCTCGCGGC
ACCATTTTCTGGGAGGCCGAGCGTGACGAGTGCGACACGGCTTCCGAAAATGCCAGCGATGTGTCGAGCAACAGG
AGCTGCGAGCCCGATCAGGGCACAAAGACGTGGGGCAAGCCCTTTAAGCTCGAGTGGCTGTCCGTGACACGACTG
CCCTTTTACAGAACAAGAGGCCTTCGAAATCCCTGGAACTCCAACAGAGAGGTCAAGATTGCCCGAGACGGAACC
GAGTTGGAGCCGTCCGTGGGCCGCAAGCTCATTGGCCTCTTCAACCGCATCCAGAGCCCGGGGTTGGCATCGTCC
ATGATGCGTCCGCCCGTGGCTGCAATGCACCTCATGGCGCCAATCTGA
Gene >OphauG2|7438
ATGGGAGACGTGCCGGTTCATTCAGCCTCCGAGGCAGCACAAGTCTCTCTTGCCGGCGTCGACGCCAAACAAAAG
CCCAAACAGCCGGCGACGATAGCCTCCAGCCACCAGGCTTTTGCGTCGCAGCTCGACATGGCCAGCCAGCAGACG
CACCAAGGCTCATACCAGGCGCCACCCCTGGGCGGCTATCGTCCAGGCCAGTATCCTCCCCCGCCCGCGCACCGC
TACATGTCGCCCATCATGACGCAGATGCCTCACATGGCCCAGTATGGGGCGCCACCAATGGCATACTACATGCAC
CAGGCGCCCATGAGCCCCTACTACGCAGCTGGCCACGGTCCGCCCTCGCACATGCCGAGCCCCAGGCACAACATG
GCCTACTACGCAAGCCATGTTGTCATGGGACAAGCCCAGCCGGGCTTTTACTACCAGCAGCCGGCCCATGAGTAT
TCCATGCCGCCACAGCCACAGCCCATGCTTGTGGCAGCTGATGTCTCCCCAAGGCCCCCTGATGCTCCAGATGCA
CCACCGCCAGCTCATGGCTATAGTTGCCTTGGTGACAGCAATGGCACAGGCCCAGGTAAGCAGCATGTCGCCTCG
CCACGCCAATCAAGACGCAGCTCACCCTGCCCCGAGCAGATCAGGGCCATGACGGGCACAAGACTGTGCGAGGAC
CTCCTAGAAAGCCTCGTCAGAGCGGTAAGCAGACAGCGGCCGGCACAGACCGTTGCCAAAGGCCGCCAGAGACTT
ACATAGCGGCTGCAGGGCACGCCATCTGGATTGGCAACCTGCCTCCCAACACGGACCTGATGAGTCTTGTCCACC
ACGTCTGCAAGGAGACCACAGGACTCGAGTCCGTCTTTCTGATTTCAAAGAGCAACTGCGCCTTTGCCAATTTCA
AAGACGACAAGACGTGTCTCGCAGCTCAGCAAACTCTGCACGATTCGAGATACGAGACGGTCCGCCTCGTCAGCC
GCTTGCGTAAAAGCACCGTCGAGGGCGTGGCTGGACTGACTGCGCCCACCGGGCCAGCCCTTCCTCCGGGCGACT
CAACACGCGGGGCTTCTCCCAATTCCACATCGAGTTCCTGTCTCAGCCCGCCCGCAAAGCCCAAGGCCAGCGCGG
CTGTCGTCGACGGCCATGCCCACCAAGACAGATTCTTCATCCTCAAAAGCTTGACCCTGGAGGACCTCGAGTTGA
GCGTGCAGACTGGCATCTGGGCTACACAGTCACACAACGAGGACACCTTGAACAATGCTTTCAAGGTCAGTCTTT
GCCGTCAAGCACACGGCGCCACCGACTGACGCCAGACGTGTACAGAAATACGACAATGTCTATCTCGTCTTCTCA
GCCAATAAGTCGGGCGAATACTTTGGCTATGCGCGCATGACTTCCGAGGTCAACAAGGACCCAGAAGCCGCCATT
GAATTCGCCCCCAAGTCGCAGGCTGCCAGTGCTCTGCAGTTGCCCAGAGCCATCGCCACAGAAGCAACCCAGCAC
GCGCCCAGGGGCACAATCATTGACGACTCGGCTCGCGGCACCATTTTCTGGGAGGCCGAGCGTGACGAGTGCGAC
ACGGCTTCCGAAAATGCCAGCGATGTGTCGAGCAACAGGAGCTGCGAGCCCGATCAGGGCACAAAGACGTGGGGC
AAGCCCTTTAAGCTCGAGTGGCTGTCCGTGACACGACTGCCCTTTTACAGAACAAGAGGCCTTCGAAATCCCTGG
AACTCCAACAGAGAGGTCAAGATTGCCCGAGACGGAACCGAGTTGGAGCCGTCCGTGGGCCGCAAGCTCATTGGC
CTCTTCAACCGCATCCAGAGCCCGGGGTTGGCATCGTCCATGATGCGTCCGCCCGTGGCTGCAATGCACCTCATG
GCGCCAATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail