Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7437
Gene name
LocationContig_868:2303..2930
Strand-
Gene length (bp)627
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 8.7E-13 146 208
PF17886 ArsA_HSP20 HSP20-like domain found in ArsA 3.4E-06 55 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19752|HSP30_NEUCR 30 kDa heat shock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp30 PE=3 SV=1 1 208 4.0E-63
sp|P40920|HSP30_EMENI 30 kDa heat shock protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp30 PE=2 SV=1 15 207 2.0E-43
sp|Q4UJB1|HSPC4_RICFE Small heat shock protein C4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspc4-1 PE=3 SV=1 148 207 9.0E-10
sp|Q8MPA7|HSPG5_DICDI Small heat shock protein hspG5 OS=Dictyostelium discoideum GN=hspG5 PE=2 SV=2 25 208 3.0E-06
sp|Q4UKR8|HSPC2_RICFE Small heat shock protein C2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspC2 PE=3 SV=1 156 207 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19752|HSP30_NEUCR 30 kDa heat shock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp30 PE=3 SV=1 1 208 4.0E-63
sp|P40920|HSP30_EMENI 30 kDa heat shock protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp30 PE=2 SV=1 15 207 2.0E-43
sp|Q4UJB1|HSPC4_RICFE Small heat shock protein C4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspc4-1 PE=3 SV=1 148 207 9.0E-10
sp|Q8MPA7|HSPG5_DICDI Small heat shock protein hspG5 OS=Dictyostelium discoideum GN=hspG5 PE=2 SV=2 25 208 3.0E-06
sp|Q4UKR8|HSPC2_RICFE Small heat shock protein C2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspC2 PE=3 SV=1 156 207 3.0E-06
sp|P12811|HS22C_CHLRE Heat shock 22 kDa protein, chloroplastic OS=Chlamydomonas reinhardtii PE=2 SV=1 142 208 4.0E-06
sp|Q86H60|HSPK_DICDI Small heat shock protein hspK OS=Dictyostelium discoideum GN=hspK PE=3 SV=1 45 207 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7437
MAFFPRNCYNADSSFTPLFRLLDDFDSYSRQNDASSSRRSGLPSWQPKFDIREVNDHYELHGDLPGVNKDQVHIE
FTDPQTMLVRGRVERAYSAGSPPAGHIEDVSNGGAITEGEDSKLPHKATVEDEGSEQSKQSSEDSVEKKLAEKKA
PSTGKWWLTERSVGEFSRSFNFPSRIEQEAVTASFKDGVLNIVVPKAKKRESRRIPIN*
Coding >OphauG2|7437
ATGGCTTTCTTTCCTCGCAACTGCTACAATGCCGACTCGTCCTTCACTCCTCTCTTCCGCCTGCTCGACGACTTT
GACAGCTATAGTCGACAGAACGATGCATCATCTTCTCGACGCTCTGGCCTGCCCTCTTGGCAGCCAAAGTTTGAC
ATCCGCGAGGTGAACGACCATTATGAGCTTCACGGCGACCTGCCCGGTGTCAACAAAGATCAAGTGCACATTGAG
TTCACCGATCCCCAGACTATGCTGGTACGCGGCCGTGTCGAGCGTGCCTATTCGGCTGGCTCGCCGCCCGCCGGC
CATATTGAGGATGTGAGCAATGGCGGTGCCATTACCGAAGGCGAGGATTCCAAACTGCCGCACAAGGCCACCGTT
GAGGATGAAGGCTCCGAGCAAAGCAAGCAAAGCTCTGAAGATAGCGTTGAGAAGAAGCTGGCTGAAAAGAAAGCG
CCGAGCACAGGCAAGTGGTGGCTCACAGAGCGCAGCGTTGGCGAGTTCTCACGAAGCTTCAATTTTCCTTCGCGC
ATTGAACAAGAAGCCGTCACAGCCTCTTTCAAGGACGGCGTCTTGAACATTGTTGTGCCCAAGGCTAAGAAGCGC
GAGTCTCGCCGCATTCCCATCAATTAG
Transcript >OphauG2|7437
ATGGCTTTCTTTCCTCGCAACTGCTACAATGCCGACTCGTCCTTCACTCCTCTCTTCCGCCTGCTCGACGACTTT
GACAGCTATAGTCGACAGAACGATGCATCATCTTCTCGACGCTCTGGCCTGCCCTCTTGGCAGCCAAAGTTTGAC
ATCCGCGAGGTGAACGACCATTATGAGCTTCACGGCGACCTGCCCGGTGTCAACAAAGATCAAGTGCACATTGAG
TTCACCGATCCCCAGACTATGCTGGTACGCGGCCGTGTCGAGCGTGCCTATTCGGCTGGCTCGCCGCCCGCCGGC
CATATTGAGGATGTGAGCAATGGCGGTGCCATTACCGAAGGCGAGGATTCCAAACTGCCGCACAAGGCCACCGTT
GAGGATGAAGGCTCCGAGCAAAGCAAGCAAAGCTCTGAAGATAGCGTTGAGAAGAAGCTGGCTGAAAAGAAAGCG
CCGAGCACAGGCAAGTGGTGGCTCACAGAGCGCAGCGTTGGCGAGTTCTCACGAAGCTTCAATTTTCCTTCGCGC
ATTGAACAAGAAGCCGTCACAGCCTCTTTCAAGGACGGCGTCTTGAACATTGTTGTGCCCAAGGCTAAGAAGCGC
GAGTCTCGCCGCATTCCCATCAATTAG
Gene >OphauG2|7437
ATGGCTTTCTTTCCTCGCAACTGCTACAATGCCGACTCGTCCTTCACTCCTCTCTTCCGCCTGCTCGACGACTTT
GACAGCTATAGTCGACAGAACGATGCATCATCTTCTCGACGCTCTGGCCTGCCCTCTTGGCAGCCAAAGTTTGAC
ATCCGCGAGGTGAACGACCATTATGAGCTTCACGGCGACCTGCCCGGTGTCAACAAAGATCAAGTGCACATTGAG
TTCACCGATCCCCAGACTATGCTGGTACGCGGCCGTGTCGAGCGTGCCTATTCGGCTGGCTCGCCGCCCGCCGGC
CATATTGAGGATGTGAGCAATGGCGGTGCCATTACCGAAGGCGAGGATTCCAAACTGCCGCACAAGGCCACCGTT
GAGGATGAAGGCTCCGAGCAAAGCAAGCAAAGCTCTGAAGATAGCGTTGAGAAGAAGCTGGCTGAAAAGAAAGCG
CCGAGCACAGGCAAGTGGTGGCTCACAGAGCGCAGCGTTGGCGAGTTCTCACGAAGCTTCAATTTTCCTTCGCGC
ATTGAACAAGAAGCCGTCACAGCCTCTTTCAAGGACGGCGTCTTGAACATTGTTGTGCCCAAGGCTAAGAAGCGC
GAGTCTCGCCGCATTCCCATCAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail