Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7434
Gene name
LocationContig_867:2570..4279
Strand+
Gene length (bp)1709
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 1.8E-72 81 414
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.6E-13 195 317
PF20434 BD-FAE BD-FAE 4.1E-10 190 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 70 537 2.0E-46
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 70 537 7.0E-45
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 60 537 3.0E-43
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 71 414 1.0E-40
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 71 414 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 70 537 2.0E-46
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 70 537 7.0E-45
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 60 537 3.0E-43
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 71 414 1.0E-40
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 71 414 1.0E-40
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 101 443 2.0E-40
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 56 414 2.0E-40
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 98 515 1.0E-39
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 98 414 2.0E-39
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 98 542 4.0E-39
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 98 414 4.0E-38
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 98 515 7.0E-38
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 98 537 1.0E-37
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 98 408 6.0E-37
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 56 414 1.0E-36
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 71 414 1.0E-36
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 56 513 2.0E-36
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 98 408 3.0E-36
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 68 414 6.0E-36
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 98 414 3.0E-35
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 98 412 4.0E-35
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 168 414 6.0E-35
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 51 530 1.0E-34
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 52 346 2.0E-34
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 98 414 2.0E-34
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 52 414 3.0E-34
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 71 531 4.0E-34
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 98 412 7.0E-34
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 98 537 1.0E-33
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 66 425 1.0E-33
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 101 450 2.0E-33
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 98 408 3.0E-33
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 75 542 4.0E-33
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 101 537 7.0E-33
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 66 425 7.0E-33
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 81 455 1.0E-32
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 81 449 1.0E-32
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 60 538 2.0E-32
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 56 408 2.0E-32
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 98 539 3.0E-32
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 98 539 3.0E-32
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 82 480 3.0E-32
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 82 408 4.0E-32
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 98 414 2.0E-31
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 81 416 2.0E-31
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 101 382 3.0E-31
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 101 408 4.0E-31
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 100 455 6.0E-31
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 101 422 7.0E-31
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 82 385 7.0E-31
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 81 455 1.0E-30
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 54 408 2.0E-30
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 95 408 3.0E-30
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 98 408 3.0E-30
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 93 352 3.0E-30
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 98 408 3.0E-30
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 101 537 3.0E-30
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 79 542 5.0E-30
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 50 408 6.0E-30
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 56 538 1.0E-29
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 98 353 1.0E-29
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 54 408 1.0E-29
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 98 408 1.0E-29
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 101 442 1.0E-29
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 54 533 1.0E-29
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 101 408 2.0E-29
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 98 408 2.0E-29
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 98 353 3.0E-29
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 60 408 4.0E-29
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 98 408 4.0E-29
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 54 408 5.0E-29
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 73 408 6.0E-29
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 54 538 7.0E-29
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 98 408 8.0E-29
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 101 463 8.0E-29
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 54 408 9.0E-29
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 101 442 1.0E-28
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 98 353 1.0E-28
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 82 530 1.0E-28
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 101 463 2.0E-28
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 98 359 8.0E-28
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 51 408 2.0E-27
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 194 465 3.0E-27
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 61 408 4.0E-27
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 73 311 4.0E-27
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 101 487 4.0E-27
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 166 286 5.0E-27
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 101 399 7.0E-27
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 101 487 1.0E-26
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 101 376 1.0E-26
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 101 413 2.0E-26
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 166 287 2.0E-26
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 101 408 3.0E-26
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 101 399 3.0E-26
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 101 533 3.0E-26
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 101 487 4.0E-26
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 101 413 5.0E-26
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 101 408 7.0E-26
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 101 399 9.0E-26
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 101 399 1.0E-25
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 166 286 1.0E-25
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 101 411 2.0E-25
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 101 413 2.0E-25
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 166 286 2.0E-25
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 101 399 3.0E-25
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 194 414 5.0E-25
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 101 542 6.0E-25
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 101 448 8.0E-25
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 98 408 1.0E-24
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 56 536 1.0E-24
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 101 463 2.0E-24
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 99 311 4.0E-24
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 73 408 2.0E-23
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 101 463 2.0E-23
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 172 360 2.0E-23
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 101 513 3.0E-23
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 55 408 6.0E-23
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 57 414 9.0E-23
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 55 408 2.0E-22
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 93 309 4.0E-22
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 101 355 1.0E-21
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 101 376 3.0E-21
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 98 360 6.0E-21
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 54 399 7.0E-21
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 98 408 7.0E-21
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 101 333 1.0E-20
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 98 360 3.0E-20
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 101 396 2.0E-19
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 80 286 6.0E-19
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 66 312 8.0E-19
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 52 401 2.0E-15
sp|P81429|EST1_SCHGA Esterase SG1 (Fragment) OS=Schizaphis graminum GN=SG1 PE=1 SV=1 98 264 2.0E-14
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 169 432 3.0E-13
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 172 382 2.0E-11
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 98 286 5.0E-11
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 101 307 7.0E-11
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 101 237 1.0E-10
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 101 237 1.0E-10
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 101 237 1.0E-10
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 54 351 3.0E-10
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 193 282 1.0E-06
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 193 282 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup71
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7434 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|596
Ophiocordyceps camponoti-floridani Ophcf2|03558
Ophiocordyceps camponoti-floridani Ophcf2|04096
Ophiocordyceps camponoti-rufipedis Ophun1|1889
Ophiocordyceps camponoti-rufipedis Ophun1|4215
Ophiocordyceps kimflemingae Ophio5|3277
Ophiocordyceps kimflemingae Ophio5|3990
Ophiocordyceps kimflemingae Ophio5|4533
Ophiocordyceps subramaniannii Hirsu2|2152
Ophiocordyceps subramaniannii Hirsu2|3602
Ophiocordyceps subramaniannii Hirsu2|3603
Ophiocordyceps subramaniannii Hirsu2|5878
Ophiocordyceps subramaniannii Hirsu2|5879
Ophiocordyceps subramaniannii Hirsu2|6551
Ophiocordyceps subramaniannii Hirsu2|8895

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7434
MQNVISFALHGRWTIPPSLNPGTRGNDQPNTNLIDAFVASSFKTPRSGSSRLPMALLAILLGLIGSGLCCQSHKS
SQHLTATTSGIITGHWLDDVPCVVEYLGIPYAKPPVGDLRFEAPHKLDASNGTYYASDFGHDCPHSAHATPNYPR
LTSQARRIISYFSSPPGTKHSEDCLTLNIWSKATHGAHGSKKPVFVFFHGGAFAAGNTNTPFYNGKYLANEQHLV
VITVNYRLGILGFPGAPGKTQNLGLRDQRLAVQWIHDNVESFGGDARKIIIAGQSAGAVAVDYWAYAYQQDAIVH
GIIAHSGNALSFPGLSPKEAEEHWAAVVQAVGCGSNVDQISCVKRVEWTKMLDAAAAVKAAESNTRLRPMPPFSP
VPDDEVVFSNYTALNINGSFAPLPILLGNNRDEDKYYAIAAYARGVVATPKESADFVTDSFTRPVTHQAQARHDH
GVASWAYLYQADWDNTRLFPGSGAYHGVDLHMIFGASAQVSGLPTTVKQQKLTARMQHAWYLFCEDPWNGLAKIG
WPRFDMGDDKVVIFGAD*
Coding >OphauG2|7434
ATGCAAAACGTCATTTCTTTTGCGTTACACGGCAGATGGACTATTCCACCTAGTCTCAATCCTGGCACCAGGGGT
AATGATCAACCAAACACAAATCTCATCGACGCCTTTGTGGCCTCGTCTTTCAAAACGCCTCGCTCGGGTTCAAGT
CGATTACCCATGGCCCTGTTAGCCATTCTCCTTGGGCTTATAGGGAGCGGACTATGCTGCCAATCGCATAAGTCA
TCCCAACACCTCACAGCAACGACCAGCGGGATAATCACTGGCCACTGGTTAGACGACGTGCCTTGCGTTGTTGAA
TACCTGGGCATTCCGTATGCCAAGCCCCCTGTGGGTGACTTGCGGTTCGAGGCGCCCCACAAACTCGACGCCTCT
AATGGAACATACTACGCGTCCGACTTTGGACACGACTGTCCGCACAGCGCCCATGCCACGCCCAACTATCCACGC
TTGACGTCTCAAGCTCGGAGAATCATTTCTTACTTTTCCTCGCCGCCTGGCACCAAGCACAGCGAAGATTGCCTG
ACTCTCAATATCTGGTCCAAGGCGACTCATGGCGCTCATGGCTCCAAGAAGCCAGTCTTTGTCTTTTTCCATGGC
GGAGCGTTTGCCGCTGGAAATACAAACACTCCGTTTTATAATGGCAAATACCTTGCCAATGAGCAGCATCTTGTC
GTCATTACCGTCAACTATCGACTTGGCATCTTGGGCTTCCCAGGCGCGCCGGGCAAGACGCAAAACCTTGGCTTG
CGAGACCAGCGCCTAGCCGTGCAATGGATCCATGACAATGTCGAATCATTTGGAGGAGATGCTCGCAAAATCATC
ATTGCGGGTCAGTCAGCAGGCGCTGTAGCTGTGGATTACTGGGCCTATGCGTACCAACAAGATGCAATTGTTCAC
GGCATTATTGCCCACTCAGGAAACGCACTTAGCTTCCCGGGCCTGTCTCCCAAAGAGGCAGAGGAGCACTGGGCA
GCTGTGGTACAAGCAGTGGGATGTGGCAGCAATGTCGATCAAATCTCGTGTGTAAAAAGAGTTGAGTGGACAAAG
ATGCTCGACGCCGCAGCTGCTGTCAAGGCTGCAGAGAGCAATACTCGACTTCGGCCCATGCCGCCCTTTTCTCCA
GTGCCTGACGATGAAGTCGTCTTCTCCAACTATACCGCTTTAAACATCAACGGCTCCTTTGCTCCGTTGCCCATT
CTTCTTGGCAACAATCGCGACGAGGACAAATACTATGCCATAGCCGCCTATGCGCGTGGCGTCGTTGCCACACCC
AAAGAATCTGCCGACTTTGTCACGGATTCCTTTACCCGCCCCGTAACGCATCAAGCTCAAGCGCGCCATGACCAC
GGCGTAGCTTCATGGGCTTATCTCTACCAAGCAGACTGGGACAATACCCGACTCTTTCCAGGAAGCGGCGCATAT
CACGGCGTCGATTTACACATGATTTTTGGTGCATCTGCTCAAGTTAGCGGCCTCCCGACAACGGTGAAGCAACAA
AAGCTCACGGCGCGGATGCAGCATGCTTGGTACCTTTTCTGCGAGGATCCGTGGAATGGACTGGCGAAGATAGGA
TGGCCGAGGTTTGATATGGGGGATGATAAAGTTGTGATTTTTGGGGCAGACTGA
Transcript >OphauG2|7434
ATGCAAAACGTCATTTCTTTTGCGTTACACGGCAGATGGACTATTCCACCTAGTCTCAATCCTGGCACCAGGGGT
AATGATCAACCAAACACAAATCTCATCGACGCCTTTGTGGCCTCGTCTTTCAAAACGCCTCGCTCGGGTTCAAGT
CGATTACCCATGGCCCTGTTAGCCATTCTCCTTGGGCTTATAGGGAGCGGACTATGCTGCCAATCGCATAAGTCA
TCCCAACACCTCACAGCAACGACCAGCGGGATAATCACTGGCCACTGGTTAGACGACGTGCCTTGCGTTGTTGAA
TACCTGGGCATTCCGTATGCCAAGCCCCCTGTGGGTGACTTGCGGTTCGAGGCGCCCCACAAACTCGACGCCTCT
AATGGAACATACTACGCGTCCGACTTTGGACACGACTGTCCGCACAGCGCCCATGCCACGCCCAACTATCCACGC
TTGACGTCTCAAGCTCGGAGAATCATTTCTTACTTTTCCTCGCCGCCTGGCACCAAGCACAGCGAAGATTGCCTG
ACTCTCAATATCTGGTCCAAGGCGACTCATGGCGCTCATGGCTCCAAGAAGCCAGTCTTTGTCTTTTTCCATGGC
GGAGCGTTTGCCGCTGGAAATACAAACACTCCGTTTTATAATGGCAAATACCTTGCCAATGAGCAGCATCTTGTC
GTCATTACCGTCAACTATCGACTTGGCATCTTGGGCTTCCCAGGCGCGCCGGGCAAGACGCAAAACCTTGGCTTG
CGAGACCAGCGCCTAGCCGTGCAATGGATCCATGACAATGTCGAATCATTTGGAGGAGATGCTCGCAAAATCATC
ATTGCGGGTCAGTCAGCAGGCGCTGTAGCTGTGGATTACTGGGCCTATGCGTACCAACAAGATGCAATTGTTCAC
GGCATTATTGCCCACTCAGGAAACGCACTTAGCTTCCCGGGCCTGTCTCCCAAAGAGGCAGAGGAGCACTGGGCA
GCTGTGGTACAAGCAGTGGGATGTGGCAGCAATGTCGATCAAATCTCGTGTGTAAAAAGAGTTGAGTGGACAAAG
ATGCTCGACGCCGCAGCTGCTGTCAAGGCTGCAGAGAGCAATACTCGACTTCGGCCCATGCCGCCCTTTTCTCCA
GTGCCTGACGATGAAGTCGTCTTCTCCAACTATACCGCTTTAAACATCAACGGCTCCTTTGCTCCGTTGCCCATT
CTTCTTGGCAACAATCGCGACGAGGACAAATACTATGCCATAGCCGCCTATGCGCGTGGCGTCGTTGCCACACCC
AAAGAATCTGCCGACTTTGTCACGGATTCCTTTACCCGCCCCGTAACGCATCAAGCTCAAGCGCGCCATGACCAC
GGCGTAGCTTCATGGGCTTATCTCTACCAAGCAGACTGGGACAATACCCGACTCTTTCCAGGAAGCGGCGCATAT
CACGGCGTCGATTTACACATGATTTTTGGTGCATCTGCTCAAGTTAGCGGCCTCCCGACAACGGTGAAGCAACAA
AAGCTCACGGCGCGGATGCAGCATGCTTGGTACCTTTTCTGCGAGGATCCGTGGAATGGACTGGCGAAGATAGGA
TGGCCGAGGTTTGATATGGGGGATGATAAAGTTGTGATTTTTGGGGCAGACTGA
Gene >OphauG2|7434
ATGCAAAACGTCATTTCTTTTGCGTTACACGGCAGATGGACTATTCCACCTAGTCTCAATCCTGGCACCAGGGGT
AATGATCAACCAAACACAAATCTCATCGACGCCTTTGTGGCCTCGTCTTTCAAAACGCCTCGCTCGGGTTCAAGT
CGATTACCCATGGCCCTGTTAGCCATTCTCCTTGGGCTTATAGGGAGCGGACTATGCTGCCAATCGCATAAGTCA
TCCCAACACCTCACAGCAACGACCAGCGGGATAATCACTGGCCACTGGTTAGACGACGTGCCTTGCGTTGTTGAA
TACCTGGGCATTCCGTATGCCAAGCCCCCTGTGGGTGACTTGCGGTTCGAGGCGCCCCACAAACTCGACGCCTCT
AATGGAACATACTACGCGTCCGACTTTGGACACGACTGTCCGCACAGCGCCCATGCCACGCCCAACTATCCACGC
TTGACGTCTCAAGCTCGGAGAATCATTTCTTACTTTTCCTCGCCGCCTGGCACCAAGCACAGCGAAGATTGCCTG
ACTCTCAATATCTGGTCCAAGGCGACTCATGGCGCTCATGGCTCCAAGAAGCCAGTCTTTGTCTTTTTCCATGGC
GGAGGTGAGATGCTATTGCCGTGGTTGTTTTATTACATCTTGTTTTATTTCGAATACACGGCAACTCACACGCCC
CATTGTCAGCGTTTGCCGCTGGAAATACAAACACTCCGTTTTATAATGGCAAATACCTTGCCAATGAGCAGCATC
TTGTCGTCATTACCGTCAACTATCGACTTGGCATCTTGGGCTTCCCAGGCGCGCCGGGCAAGACGCAAAACCTTG
GCTTGCGAGACCAGCGCCTAGCCGTGCAATGGATCCATGACAATGTCGAATCATTTGGAGGAGATGCTCGCAAAA
TCATCATTGCGGGTCAGTCAGCAGGCGCTGTAGCTGTGGATTACTGGGCCTATGCGTACCAACAAGATGCAATTG
TTCACGGCATTATTGCCCACTCAGGAAACGCACTTAGCTTCCCGGGCCTGTCTCCCAAAGAGGCAGAGGAGCACT
GGGCAGCTGTGGTACAAGCAGTGGGATGTGGCAGCAATGTCGATCAAATCTCGTGTGTAAAAAGAGTTGAGTGGA
CAAAGATGCTCGACGCCGCAGCTGCTGTCAAGGCTGCAGAGAGCAATACTCGACTTCGGCCCATGCCGCCCTTTT
CTCCAGTGCCTGACGATGAAGTCGTCTTCTCCAACTATACCGCTTTAAACATCAACGGCTCCTTTGCTCCGTTGC
CCATTCTTCTTGGCAACAATCGCGACGAGGACAAATACTATGCCATAGCCGCCTATGCGCGTGGCGTCGTTGCCA
CACCCAAAGAATCTGCCGACTTTGTCACGGATTCCTTTACCCGCCCCGTAACGCATCAAGCTCAAGCGCGCCATG
ACCACGGCGTAGCTTCATGGGCTTATCTCTACCAAGCAGACTGGGACAATACCCGACTCTTTCCAGGAAGCGGCG
CATATCACGGCGTCGATTTACACATGATTTTTGGTGCATCTGCTCAAGTTAGCGGCCTCCCGACAACGGTGAAGC
AACAAAAGCTCACGGCGCGGATGCAGCATGCTTGGTACCTTTTCTGCGAGGATCCGTGGAATGGACTGGCGAAGA
TAGGATGGCCGAGGTTTGATATGGGGGATGATAAAGTTGTGATTTTTGGGGCAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail