Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7433
Gene name
LocationContig_867:81..1173
Strand-
Gene length (bp)1092
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup515
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7433 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1555
Ophiocordyceps australis map64 (Brazil) OphauB2|595
Ophiocordyceps camponoti-floridani Ophcf2|06721
Ophiocordyceps camponoti-floridani Ophcf2|07183
Ophiocordyceps camponoti-rufipedis Ophun1|2349
Ophiocordyceps camponoti-rufipedis Ophun1|462
Ophiocordyceps kimflemingae Ophio5|3679
Ophiocordyceps subramaniannii Hirsu2|226

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7433
MVIVQAMVKYAMRQSEADSMTYVYEVSSSPNMVLSVHPSRAYASAWALGGVMASQVHRVAARLPGQTWESLFWVA
NPEYDPAWDQFHTAGWQPQLSGFLYDHPIWYEQEQYGWTDPPAVGITRRAEAYMFMNSITRNEDVRRMLNWRGTL
PLLESQPQDMDDEIKNAMALAFPWETVEIPEEILQSITIGRMTNEECIATITAIFNSFWITNLGMHHKRSASLEG
KAGKTRKASCGKLLTTVRHLRSTSSGRFNEAEVCKEFSRLKFQLSLADKPATQTDDLVFLELPVNRKVLLVEKPG
PGYKEWHELNISAIFGKETIRAEEISYIEILSSASSYPFKRQAWTLKGMPCACQARSMAPQTY*
Coding >OphauG2|7433
ATGGTCATTGTGCAAGCAATGGTGAAATACGCCATGAGACAGAGCGAAGCTGATTCAATGACATATGTTTACGAA
GTTTCCTCATCGCCAAACATGGTGCTATCGGTGCACCCGTCGCGCGCCTATGCCTCAGCTTGGGCGTTGGGAGGA
GTTATGGCTTCCCAAGTGCATCGAGTGGCCGCGAGACTGCCGGGGCAAACGTGGGAGTCTTTGTTTTGGGTGGCG
AATCCTGAATATGACCCGGCTTGGGATCAATTCCACACTGCTGGTTGGCAGCCACAGCTATCCGGATTTCTTTAC
GATCATCCGATCTGGTATGAACAGGAACAGTATGGATGGACAGATCCTCCAGCGGTTGGCATAACACGCCGCGCC
GAGGCCTATATGTTTATGAACTCGATTACGAGAAACGAAGACGTTCGAAGAATGCTGAATTGGAGAGGCACCTTG
CCTCTGCTTGAGTCGCAACCTCAAGACATGGATGACGAAATCAAGAACGCCATGGCCCTGGCGTTTCCTTGGGAA
ACAGTGGAAATTCCCGAAGAGATTTTGCAAAGCATCACTATTGGCAGAATGACAAACGAGGAATGCATTGCCACC
ATTACAGCCATTTTTAATTCGTTTTGGATAACCAACTTGGGAATGCACCATAAACGCTCGGCCTCGTTAGAAGGC
AAAGCGGGCAAGACTAGAAAAGCTTCTTGCGGCAAACTTTTAACCACGGTCAGGCATCTCAGGAGCACTAGCTCG
GGACGATTCAACGAGGCTGAAGTGTGCAAGGAGTTTAGTCGGCTTAAATTTCAGCTTTCCTTGGCAGATAAGCCT
GCAACCCAGACGGATGACTTGGTTTTTCTCGAATTGCCCGTGAATAGAAAAGTTCTCCTTGTTGAGAAGCCTGGG
CCTGGATACAAGGAGTGGCACGAGCTGAACATATCAGCCATATTCGGCAAGGAAACAATCCGAGCTGAGGAGATT
TCCTATATAGAAATCTTGTCTTCAGCATCTTCTTATCCGTTTAAACGTCAAGCTTGGACTCTCAAAGGTATGCCG
TGCGCTTGTCAAGCTCGCTCGATGGCGCCACAGACATACTGA
Transcript >OphauG2|7433
ATGGTCATTGTGCAAGCAATGGTGAAATACGCCATGAGACAGAGCGAAGCTGATTCAATGACATATGTTTACGAA
GTTTCCTCATCGCCAAACATGGTGCTATCGGTGCACCCGTCGCGCGCCTATGCCTCAGCTTGGGCGTTGGGAGGA
GTTATGGCTTCCCAAGTGCATCGAGTGGCCGCGAGACTGCCGGGGCAAACGTGGGAGTCTTTGTTTTGGGTGGCG
AATCCTGAATATGACCCGGCTTGGGATCAATTCCACACTGCTGGTTGGCAGCCACAGCTATCCGGATTTCTTTAC
GATCATCCGATCTGGTATGAACAGGAACAGTATGGATGGACAGATCCTCCAGCGGTTGGCATAACACGCCGCGCC
GAGGCCTATATGTTTATGAACTCGATTACGAGAAACGAAGACGTTCGAAGAATGCTGAATTGGAGAGGCACCTTG
CCTCTGCTTGAGTCGCAACCTCAAGACATGGATGACGAAATCAAGAACGCCATGGCCCTGGCGTTTCCTTGGGAA
ACAGTGGAAATTCCCGAAGAGATTTTGCAAAGCATCACTATTGGCAGAATGACAAACGAGGAATGCATTGCCACC
ATTACAGCCATTTTTAATTCGTTTTGGATAACCAACTTGGGAATGCACCATAAACGCTCGGCCTCGTTAGAAGGC
AAAGCGGGCAAGACTAGAAAAGCTTCTTGCGGCAAACTTTTAACCACGGTCAGGCATCTCAGGAGCACTAGCTCG
GGACGATTCAACGAGGCTGAAGTGTGCAAGGAGTTTAGTCGGCTTAAATTTCAGCTTTCCTTGGCAGATAAGCCT
GCAACCCAGACGGATGACTTGGTTTTTCTCGAATTGCCCGTGAATAGAAAAGTTCTCCTTGTTGAGAAGCCTGGG
CCTGGATACAAGGAGTGGCACGAGCTGAACATATCAGCCATATTCGGCAAGGAAACAATCCGAGCTGAGGAGATT
TCCTATATAGAAATCTTGTCTTCAGCATCTTCTTATCCGTTTAAACGTCAAGCTTGGACTCTCAAAGGTATGCCG
TGCGCTTGTCAAGCTCGCTCGATGGCGCCACAGACATACTGA
Gene >OphauG2|7433
ATGGTCATTGTGCAAGCAATGGTGAAATACGCCATGAGACAGAGCGAAGCTGATTCAATGACATATGTTTACGAA
GTTTCCTCATCGCCAAACATGGTGCTATCGGTGCACCCGTCGCGCGCCTATGCCTCAGCTTGGGCGTTGGGAGGA
GTTATGGCTTCCCAAGTGCATCGAGTGGCCGCGAGACTGCCGGGGCAAACGTGGGAGTCTTTGTTTTGGGTGGCG
AATCCTGAATATGACCCGGCTTGGGATCAATTCCACACTGCTGGTTGGCAGCCACAGCTATCCGGATTTCTTTAC
GATCATCCGATCTGGTATGAACAGGAACAGTATGGATGGACAGATCCTCCAGCGGTTGGCATAACACGCCGCGCC
GAGGCCTATATGTTTATGAACTCGATTACGAGAAACGAAGACGTTCGAAGAATGCTGAATTGGAGAGGCACCTTG
CCTCTGCTTGAGTCGCAACCTCAAGACATGGATGACGAAATCAAGAACGCCATGGCCCTGGCGTTTCCTTGGGAA
ACAGTGGAAATTCCCGAAGAGATTTTGCAAAGCATCACTATTGGCAGAATGACAAACGAGGAATGCATTGCCACC
ATTACAGCCATTTTTAATTCGTTTTGGATAACCAACTTGGGAATGCACCATAAACGCTCGGCCTCGTTAGAAGGC
AAAGCGGGCAAGACTAGAAAAGCTTCTTGCGGCAAACTTTTAACCACGGTCAGGCATCTCAGGAGCACTAGCTCG
GGACGATTCAACGAGGCTGAAGTGTGCAAGGAGTTTAGTCGGCTTAAATTTCAGCTTTCCTTGGCAGATAAGCCT
GCAACCCAGACGGATGACTTGGTTTTTCTCGAATTGCCCGTGAATAGAAAAGTTCTCCTTGTTGAGAAGCCTGGG
CCTGGATACAAGGAGTGGCACGAGCTGAACATATCAGCCATATTCGGCAAGGAAACAATCCGAGCTGAGGAGATT
TCCTATATAGAAATCTTGTCTTCAGCATCTTCTTATCCGTTTAAACGTCAAGCTTGGACTCTCAAAGGTATGCCG
TGCGCTTGTCAAGCTCGCTCGATGGCGCCACAGACATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail