Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7427
Gene name
LocationContig_864:4452..5718
Strand-
Gene length (bp)1266
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 156 407 2.0E-67
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 145 407 8.0E-67
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 155 407 5.0E-58
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 154 406 8.0E-38
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 154 406 8.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 156 407 2.0E-67
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 145 407 8.0E-67
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 155 407 5.0E-58
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 154 406 8.0E-38
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 154 406 8.0E-38
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 154 406 1.0E-37
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 154 406 1.0E-37
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 154 406 2.0E-37
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 154 406 2.0E-36
sp|Q5BD29|BTGE_EMENI Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgE PE=1 SV=1 154 406 8.0E-36
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 154 406 9.0E-35
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 156 407 3.0E-33
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 164 407 3.0E-19
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 164 407 3.0E-17
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 164 407 6.0E-17
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 162 395 1.0E-16
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 154 407 1.0E-16
sp|Q2U492|BTGC_ASPOR Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgC PE=3 SV=1 169 407 2.0E-14
sp|B8NTP7|BTGC_ASPFN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgC PE=3 SV=2 169 407 2.0E-14
sp|A1CAI0|BTGC_ASPCL Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgC PE=3 SV=1 169 407 1.0E-11
sp|A1DEV5|BTGC_NEOFI Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgC PE=3 SV=1 169 407 2.0E-11
sp|Q0CI96|BTGC_ASPTN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgC PE=3 SV=2 114 407 2.0E-11
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 169 407 9.0E-11
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 152 407 1.0E-10
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 169 407 1.0E-10
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 143 364 4.0E-10
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 155 365 5.0E-10
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 155 365 2.0E-09
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 155 365 3.0E-09
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 143 377 4.0E-09
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 155 364 1.0E-07
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 155 357 3.0E-07
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 143 365 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7427
MALAPLAAAFPRSVEGFRASWPEHQEYVGHVLDTQDYVLYDASVTEPTRVPQLVIALDQGDKSVETAVRDVLLLP
TRLAPKRFDDDGPSSTTQLSSHTTLPSLVPSTASTPPMQSPAGSDTSSSSQSSWQPVATSAPQDPTPALDPTTSA
PVLFGVSYAPYRADGQCKTRQDIKADFEQLAGLYSLVRIYGTDCDQVANICSIARAHGIKVFLGIWNANKIEYEA
QQIISGVDNNWDLIDTVSVGNELIHKREMDPKQLVLAVNRARSILRKAGYDGPVVTVDTFGQVLQHPELCESSDY
CAINAHPFYDKHITAEQSGRWLRDRVKEVRSVFKTPKRIVVAETGWPTSGEANGLAVPGLEAQRSAIESIKSAFV
NEPANIILFSAFNDLWKTNSLETFNAEKSWGIDGAMAPSDTGLARI*
Coding >OphauG2|7427
ATGGCCCTGGCGCCTCTGGCGGCTGCATTCCCTCGATCAGTTGAAGGATTCAGAGCATCCTGGCCAGAACACCAA
GAGTATGTTGGCCACGTTTTGGACACGCAAGATTACGTCTTGTACGATGCGTCAGTGACGGAGCCAACACGGGTG
CCCCAACTGGTCATCGCACTCGACCAGGGCGACAAGAGCGTGGAAACGGCTGTGCGAGATGTGCTGCTCCTCCCG
ACTCGCCTGGCACCCAAACGCTTTGACGACGACGGCCCAAGCAGTACTACCCAGCTTTCCTCGCATACCACTTTG
CCGAGTCTTGTTCCGTCTACAGCTTCTACTCCTCCAATGCAATCGCCAGCAGGGAGCGACACTTCTTCTTCTTCT
CAGAGTTCATGGCAACCTGTTGCCACCAGTGCGCCACAGGACCCAACTCCAGCTCTGGACCCCACGACCTCAGCG
CCGGTGCTTTTTGGAGTATCATATGCGCCGTACCGTGCTGACGGGCAATGCAAAACACGACAGGACATCAAAGCC
GACTTTGAGCAGCTGGCTGGCTTGTATAGTTTGGTCCGCATATATGGGACCGACTGTGACCAAGTGGCCAATATA
TGCTCCATTGCCCGTGCTCATGGCATAAAGGTTTTCCTCGGCATCTGGAACGCCAACAAGATTGAGTATGAAGCT
CAACAAATCATTTCTGGAGTCGACAACAACTGGGACCTCATAGACACAGTGAGCGTTGGCAATGAGCTGATTCAC
AAGAGGGAGATGGACCCCAAACAGCTTGTTTTAGCCGTCAATCGAGCGCGGTCCATACTCCGCAAGGCTGGATAT
GACGGCCCGGTCGTCACTGTCGATACATTTGGCCAGGTACTGCAGCACCCTGAGCTGTGCGAGAGTTCAGATTAC
TGCGCGATAAATGCACATCCCTTTTATGATAAACACATAACGGCTGAACAGTCAGGCCGTTGGCTTCGAGACCGA
GTCAAGGAGGTCAGGTCGGTTTTCAAGACGCCAAAGCGCATTGTTGTGGCCGAGACGGGATGGCCAACAAGTGGC
GAGGCCAATGGCTTGGCCGTGCCAGGCCTCGAAGCTCAGCGAAGCGCAATTGAATCCATAAAGAGCGCTTTTGTC
AACGAACCCGCCAATATTATCCTATTTTCCGCTTTCAACGACCTCTGGAAGACCAACAGTCTCGAAACATTCAAC
GCTGAAAAGAGCTGGGGTATTGATGGCGCCATGGCGCCTAGTGATACAGGACTCGCTAGAATCTGA
Transcript >OphauG2|7427
ATGGCCCTGGCGCCTCTGGCGGCTGCATTCCCTCGATCAGTTGAAGGATTCAGAGCATCCTGGCCAGAACACCAA
GAGTATGTTGGCCACGTTTTGGACACGCAAGATTACGTCTTGTACGATGCGTCAGTGACGGAGCCAACACGGGTG
CCCCAACTGGTCATCGCACTCGACCAGGGCGACAAGAGCGTGGAAACGGCTGTGCGAGATGTGCTGCTCCTCCCG
ACTCGCCTGGCACCCAAACGCTTTGACGACGACGGCCCAAGCAGTACTACCCAGCTTTCCTCGCATACCACTTTG
CCGAGTCTTGTTCCGTCTACAGCTTCTACTCCTCCAATGCAATCGCCAGCAGGGAGCGACACTTCTTCTTCTTCT
CAGAGTTCATGGCAACCTGTTGCCACCAGTGCGCCACAGGACCCAACTCCAGCTCTGGACCCCACGACCTCAGCG
CCGGTGCTTTTTGGAGTATCATATGCGCCGTACCGTGCTGACGGGCAATGCAAAACACGACAGGACATCAAAGCC
GACTTTGAGCAGCTGGCTGGCTTGTATAGTTTGGTCCGCATATATGGGACCGACTGTGACCAAGTGGCCAATATA
TGCTCCATTGCCCGTGCTCATGGCATAAAGGTTTTCCTCGGCATCTGGAACGCCAACAAGATTGAGTATGAAGCT
CAACAAATCATTTCTGGAGTCGACAACAACTGGGACCTCATAGACACAGTGAGCGTTGGCAATGAGCTGATTCAC
AAGAGGGAGATGGACCCCAAACAGCTTGTTTTAGCCGTCAATCGAGCGCGGTCCATACTCCGCAAGGCTGGATAT
GACGGCCCGGTCGTCACTGTCGATACATTTGGCCAGGTACTGCAGCACCCTGAGCTGTGCGAGAGTTCAGATTAC
TGCGCGATAAATGCACATCCCTTTTATGATAAACACATAACGGCTGAACAGTCAGGCCGTTGGCTTCGAGACCGA
GTCAAGGAGGTCAGGTCGGTTTTCAAGACGCCAAAGCGCATTGTTGTGGCCGAGACGGGATGGCCAACAAGTGGC
GAGGCCAATGGCTTGGCCGTGCCAGGCCTCGAAGCTCAGCGAAGCGCAATTGAATCCATAAAGAGCGCTTTTGTC
AACGAACCCGCCAATATTATCCTATTTTCCGCTTTCAACGACCTCTGGAAGACCAACAGTCTCGAAACATTCAAC
GCTGAAAAGAGCTGGGGTATTGATGGCGCCATGGCGCCTAGTGATACAGGACTCGCTAGAATCTGA
Gene >OphauG2|7427
ATGGCCCTGGCGCCTCTGGCGGCTGCATTCCCTCGATCAGTTGAAGGATTCAGAGCATCCTGGCCAGAACACCAA
GAGTATGTTGGCCACGTTTTGGACACGCAAGATTACGTCTTGTACGATGCGTCAGTGACGGAGCCAACACGGGTG
CCCCAACTGGTCATCGCACTCGACCAGGGCGACAAGAGCGTGGAAACGGCTGTGCGAGATGTGCTGCTCCTCCCG
ACTCGCCTGGCACCCAAACGCTTTGACGACGACGGCCCAAGCAGTACTACCCAGCTTTCCTCGCATACCACTTTG
CCGAGTCTTGTTCCGTCTACAGCTTCTACTCCTCCAATGCAATCGCCAGCAGGGAGCGACACTTCTTCTTCTTCT
CAGAGTTCATGGCAACCTGTTGCCACCAGTGCGCCACAGGACCCAACTCCAGCTCTGGACCCCACGACCTCAGCG
CCGGTGCTTTTTGGAGTATCATATGCGCCGTACCGTGCTGACGGGCAATGCAAAACACGACAGGACATCAAAGCC
GACTTTGAGCAGCTGGCTGGCTTGTATAGTTTGGTCCGCATATATGGGACCGACTGTGACCAAGTGGCCAATATA
TGCTCCATTGCCCGTGCTCATGGCATAAAGGTTTTCCTCGGCATCTGGAACGCCAACAAGATTGAGTATGAAGCT
CAACAAATCATTTCTGGAGTCGACAACAACTGGGACCTCATAGACACAGTGAGCGTTGGCAATGAGCTGATTCAC
AAGAGGGAGATGGACCCCAAACAGCTTGTTTTAGCCGTCAATCGAGCGCGGTCCATACTCCGCAAGGCTGGATAT
GACGGCCCGGTCGTCACTGTCGATACATTTGGCCAGGTACTGCAGCACCCTGAGCTGTGCGAGAGTTCAGATTAC
TGCGCGATAAATGCACATCCCTTTTATGATAAACACATAACGGCTGAACAGTCAGGCCGTTGGCTTCGAGACCGA
GTCAAGGAGGTCAGGTCGGTTTTCAAGACGCCAAAGCGCATTGTTGTGGCCGAGACGGGATGGCCAACAAGTGGC
GAGGCCAATGGCTTGGCCGTGCCAGGCCTCGAAGCTCAGCGAAGCGCAATTGAATCCATAAAGAGCGCTTTTGTC
AACGAACCCGCCAATATTATCCTATTTTCCGCTTTCAACGACCTCTGGAAGACCAACAGTCTCGAAACATTCAAC
GCTGAAAAGAGCTGGGGTATTGATGGCGCCATGGCGCCTAGTGATACAGGACTCGCTAGAATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail