Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7410
Gene name
LocationContig_86:9580..10688
Strand-
Gene length (bp)1108
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02374 ArsA_ATPase Anion-transporting ATPase 1.5E-106 27 337
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 2.5E-12 29 153
PF13614 AAA_31 AAA domain 1.6E-11 33 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870U4|GET3_NEUCR ATPase get3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get3 PE=3 SV=1 1 344 0.0E+00
sp|A7EHP6|GET3_SCLS1 ATPase get3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|A6S7T2|GET3_BOTFB ATPase get3 OS=Botryotinia fuckeliana (strain B05.10) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|Q2GXW1|GET3_CHAGB ATPase GET3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GET3 PE=3 SV=1 1 343 0.0E+00
sp|A4QUI2|GET3_MAGO7 ATPase GET3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GET3 PE=3 SV=1 1 344 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870U4|GET3_NEUCR ATPase get3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get3 PE=3 SV=1 1 344 0.0E+00
sp|A7EHP6|GET3_SCLS1 ATPase get3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|A6S7T2|GET3_BOTFB ATPase get3 OS=Botryotinia fuckeliana (strain B05.10) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|Q2GXW1|GET3_CHAGB ATPase GET3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GET3 PE=3 SV=1 1 343 0.0E+00
sp|A4QUI2|GET3_MAGO7 ATPase GET3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GET3 PE=3 SV=1 1 344 0.0E+00
sp|B6Q334|GET3_TALMQ ATPase get3 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=get3 PE=3 SV=1 2 344 0.0E+00
sp|B8M4Y9|GET3_TALSN ATPase get3 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=get3 PE=3 SV=1 2 344 0.0E+00
sp|A5AAA1|GET3_ASPNC ATPase get3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=get3 PE=3 SV=1 1 344 0.0E+00
sp|B6H443|GET3_PENRW ATPase get3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=get3 PE=3 SV=1 1 344 0.0E+00
sp|A1D6T7|GET3_NEOFI ATPase get3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=get3 PE=3 SV=1 2 344 0.0E+00
sp|B2B7D9|GET3_PODAN ATPase GET3 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GET3 PE=3 SV=1 1 343 0.0E+00
sp|Q1E167|GET3_COCIM ATPase GET3 OS=Coccidioides immitis (strain RS) GN=GET3 PE=3 SV=1 1 345 0.0E+00
sp|C4JZ54|GET3_UNCRE ATPase GET3 OS=Uncinocarpus reesii (strain UAMH 1704) GN=GET3 PE=3 SV=1 1 345 0.0E+00
sp|A6QRP2|GET3_AJECN ATPase GET3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GET3 PE=3 SV=1 2 345 0.0E+00
sp|C6HRP6|GET3_AJECH ATPase GET3 OS=Ajellomyces capsulatus (strain H143) GN=GET3 PE=3 SV=1 2 345 0.0E+00
sp|C0NV23|GET3_AJECG ATPase GET3 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GET3 PE=3 SV=1 2 345 0.0E+00
sp|Q4WY07|GET3_ASPFU ATPase get3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=get3 PE=1 SV=2 2 344 0.0E+00
sp|B0XXL5|GET3_ASPFC ATPase get3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=get3 PE=3 SV=1 2 344 0.0E+00
sp|Q0CNR4|GET3_ASPTN ATPase get3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=get3 PE=3 SV=1 1 343 0.0E+00
sp|A1CKN5|GET3_ASPCL ATPase get3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=get3 PE=3 SV=1 1 344 0.0E+00
sp|Q2UKT0|GET3_ASPOR ATPase get3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=get3 PE=3 SV=1 1 344 0.0E+00
sp|B8N3P7|GET3_ASPFN ATPase get3 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=get3 PE=3 SV=2 1 344 0.0E+00
sp|B2VVF0|GET3_PYRTR ATPase get3 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=get3 PE=3 SV=1 2 344 0.0E+00
sp|Q5B971|GET3_EMENI ATPase get3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=get3 PE=3 SV=1 1 343 4.0E-180
sp|C5JUG0|GET3_AJEDS ATPase GET3 OS=Ajellomyces dermatitidis (strain SLH14081) GN=GET3 PE=3 SV=1 2 345 3.0E-178
sp|C5G9V3|GET3_AJEDR ATPase GET3 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GET3 PE=3 SV=1 2 345 3.0E-178
sp|C5P9K5|GET3_COCP7 ATPase GET3 OS=Coccidioides posadasii (strain C735) GN=GET3 PE=3 SV=1 1 330 2.0E-176
sp|Q0UP11|GET3_PHANO ATPase GET3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GET3 PE=3 SV=2 2 330 5.0E-175
sp|C5FD58|GET3_ARTOC ATPase GET3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GET3 PE=3 SV=1 2 345 3.0E-173
sp|C1GTV2|GET3_PARBA ATPase GET3 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GET3 PE=3 SV=1 1 345 1.0E-172
sp|C0S3F7|GET3_PARBP ATPase GET3 OS=Paracoccidioides brasiliensis (strain Pb03) GN=GET3 PE=3 SV=1 1 345 1.0E-172
sp|C1G182|GET3_PARBD ATPase GET3 OS=Paracoccidioides brasiliensis (strain Pb18) GN=GET3 PE=3 SV=1 1 345 1.0E-172
sp|Q4P7S5|GET3_USTMA ATPase GET3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GET3 PE=3 SV=1 1 345 2.0E-151
sp|A8N0V8|GET3_COPC7 ATPase GET3 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=GET3 PE=3 SV=1 10 345 1.0E-146
sp|P0CM24|GET3_CRYNJ ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET3 PE=3 SV=1 9 344 2.0E-146
sp|P0CM25|GET3_CRYNB ATPase GET3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET3 PE=3 SV=1 9 344 2.0E-146
sp|B6K052|GET3_SCHJY ATPase get3 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=get3 PE=3 SV=1 12 341 2.0E-144
sp|A8Q0M1|GET3_MALGO ATPase GET3 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=GET3 PE=3 SV=1 12 344 3.0E-141
sp|B0CPJ0|GET3_LACBS ATPase GET3 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GET3 PE=3 SV=2 13 344 7.0E-141
sp|Q6C3M9|GET3_YARLI ATPase GET3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET3 PE=3 SV=1 9 340 9.0E-138
sp|Q9P7F8|GET3_SCHPO ATPase get3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=get3 PE=1 SV=1 16 343 6.0E-137
sp|B2DFU2|GET3_RHOGU ATPase GET3 OS=Rhodotorula glutinis GN=GET3 PE=3 SV=1 2 340 5.0E-136
sp|Q0IIZ2|ASNA_XENTR ATPase asna1 OS=Xenopus tropicalis GN=asna1 PE=2 SV=1 7 343 6.0E-117
sp|C4R7S9|GET3_PICPG ATPase GET3 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GET3 PE=3 SV=1 14 340 3.0E-116
sp|Q6IQE5|ASNA_DANRE ATPase asna1 OS=Danio rerio GN=asna1 PE=1 SV=1 7 345 5.0E-115
sp|Q6GNQ1|ASNA_XENLA ATPase asna1 OS=Xenopus laevis GN=asna1 PE=2 SV=1 7 343 6.0E-115
sp|A3LX15|GET3_PICST ATPase GET3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GET3 PE=3 SV=1 13 342 1.0E-114
sp|O43681|ASNA_HUMAN ATPase ASNA1 OS=Homo sapiens GN=ASNA1 PE=1 SV=2 7 343 4.0E-114
sp|A5PJI5|ASNA_BOVIN ATPase ASNA1 OS=Bos taurus GN=ASNA1 PE=2 SV=1 7 343 4.0E-114
sp|O54984|ASNA_MOUSE ATPase Asna1 OS=Mus musculus GN=Asna1 PE=1 SV=2 7 343 4.0E-114
sp|A7RQM5|ASNA_NEMVE ATPase ASNA1 homolog OS=Nematostella vectensis GN=v1g161623 PE=3 SV=1 9 342 7.0E-114
sp|A5DVY5|GET3_LODEL ATPase GET3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GET3 PE=3 SV=1 10 345 2.0E-113
sp|B4J4F6|ASNA_DROGR ATPase ASNA1 homolog OS=Drosophila grimshawi GN=GH21552 PE=3 SV=1 11 344 4.0E-113
sp|B0WEV5|ASNA_CULQU ATPase ASNA1 homolog OS=Culex quinquefasciatus GN=CPIJ005690 PE=3 SV=1 9 342 6.0E-113
sp|B4N645|ASNA_DROWI ATPase ASNA1 homolog OS=Drosophila willistoni GN=GK17805 PE=3 SV=1 13 343 2.0E-112
sp|C4Y7U0|GET3_CLAL4 ATPase GET3 OS=Clavispora lusitaniae (strain ATCC 42720) GN=GET3 PE=3 SV=1 13 342 2.0E-112
sp|C5MF33|GET3_CANTT ATPase GET3 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GET3 PE=3 SV=1 13 342 4.0E-112
sp|A5DGM1|GET3_PICGU ATPase GET3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GET3 PE=3 SV=2 13 345 6.0E-112
sp|B4QEC4|ASNA_DROSI ATPase ASNA1 homolog OS=Drosophila simulans GN=GD10240 PE=3 SV=1 13 345 2.0E-111
sp|B4LN33|ASNA_DROVI ATPase ASNA1 homolog OS=Drosophila virilis GN=GJ21093 PE=3 SV=1 13 344 6.0E-111
sp|Q7JWD3|ASNA_DROME ATPase ASNA1 homolog OS=Drosophila melanogaster GN=CG1598 PE=2 SV=1 13 345 9.0E-111
sp|Q6BSM0|GET3_DEBHA ATPase GET3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GET3 PE=1 SV=1 13 342 9.0E-111
sp|P0CB55|GET3_CANAW ATPase GET3 OS=Candida albicans (strain WO-1) GN=GET3 PE=3 SV=1 13 342 1.0E-110
sp|P0CB54|GET3_CANAL ATPase GET3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET3 PE=3 SV=1 13 342 1.0E-110
sp|B4P1R6|ASNA_DROYA ATPase ASNA1 homolog OS=Drosophila yakuba GN=GE23838 PE=3 SV=1 13 342 1.0E-110
sp|B9W757|GET3_CANDC ATPase GET3 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GET3 PE=3 SV=1 13 342 1.0E-110
sp|B3N9X2|ASNA_DROER ATPase ASNA1 homolog OS=Drosophila erecta GN=GG10733 PE=3 SV=1 13 342 1.0E-110
sp|Q5TRE7|ASNA_ANOGA ATPase ASNA1 homolog OS=Anopheles gambiae GN=AGAP005782 PE=3 SV=3 14 342 1.0E-110
sp|Q16MG9|ASNA_AEDAE ATPase ASNA1 homolog OS=Aedes aegypti GN=AAEL011136 PE=3 SV=1 9 342 1.0E-110
sp|B3MHB7|ASNA_DROAN ATPase ASNA1 homolog OS=Drosophila ananassae GN=GF11712 PE=3 SV=1 13 342 2.0E-110
sp|B4KTG7|ASNA_DROMO ATPase ASNA1 homolog OS=Drosophila mojavensis GN=GI19524 PE=3 SV=1 13 344 2.0E-110
sp|B4H8J5|ASNA_DROPE ATPase ASNA1 homolog OS=Drosophila persimilis GN=GL20106 PE=3 SV=1 13 342 6.0E-110
sp|Q28YJ2|ASNA_DROPS ATPase ASNA1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA14038 PE=3 SV=1 13 342 2.0E-109
sp|Q6CPX3|GET3_KLULA ATPase GET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GET3 PE=3 SV=1 13 342 1.0E-108
sp|A8Q3T2|ASNA_BRUMA ATPase ASNA1 homolog OS=Brugia malayi GN=Bm1_42140 PE=3 SV=1 10 340 2.0E-108
sp|B4HR35|ASNA_DROSE ATPase ASNA1 homolog OS=Drosophila sechellia GN=GM20779 PE=3 SV=1 13 345 2.0E-107
sp|P30632|ASNA_CAEEL ATPase asna-1 OS=Caenorhabditis elegans GN=asna-1 PE=1 SV=1 13 341 8.0E-107
sp|Q8T662|ASNA_DICDI ATPase ASNA1 homolog OS=Dictyostelium discoideum GN=arsA PE=1 SV=1 13 342 2.0E-106
sp|Q12154|GET3_YEAST ATPase GET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET3 PE=1 SV=1 12 342 3.0E-106
sp|A6ZXM9|GET3_YEAS7 ATPase GET3 OS=Saccharomyces cerevisiae (strain YJM789) GN=GET3 PE=3 SV=1 12 342 3.0E-106
sp|B3LGZ3|GET3_YEAS1 ATPase GET3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GET3 PE=3 SV=1 12 342 3.0E-106
sp|Q759J2|GET3_ASHGO ATPase GET3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GET3 PE=3 SV=2 14 342 2.0E-105
sp|A7TH32|GET3_VANPO ATPase GET3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GET3 PE=3 SV=1 13 342 2.0E-105
sp|C5DL53|GET3_LACTC ATPase GET3 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GET3 PE=3 SV=1 14 342 3.0E-105
sp|A8WNH9|ASNA_CAEBR ATPase asna-1 OS=Caenorhabditis briggsae GN=asna-1 PE=3 SV=1 13 339 7.0E-105
sp|Q6FKZ9|GET3_CANGA ATPase GET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GET3 PE=3 SV=1 12 342 1.0E-104
sp|C5DQ05|GET3_ZYGRC ATPase GET3 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GET3 PE=3 SV=1 12 342 2.0E-102
sp|A0E7A5|ASNA2_PARTE ATPase ASNA1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00023900001 PE=3 SV=1 13 344 6.0E-99
sp|A0BZ55|ASNA1_PARTE ATPase ASNA1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00033675001 PE=3 SV=1 10 344 6.0E-99
sp|Q4CNH2|ASNA_TRYCC ATPase ASNA1 homolog OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053507763.30 PE=3 SV=1 12 340 2.0E-87
sp|Q8I1T8|ASNA_PLAF7 ATPase ASNA1 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFD0725c PE=3 SV=1 14 343 7.0E-82
sp|B9PGU1|ASNA_TOXGO ATPase ASNA1 homolog OS=Toxoplasma gondii GN=TGVEG_231190 PE=3 SV=1 13 343 1.0E-81
sp|Q7RMI2|ASNA_PLAYO ATPase ASNA1 homolog OS=Plasmodium yoelii yoelii GN=PY02198 PE=3 SV=1 14 343 5.0E-81
sp|Q4YVP3|ASNA_PLABA ATPase ASNA1 homolog OS=Plasmodium berghei (strain Anka) GN=PB000618.02.0 PE=3 SV=1 14 343 2.0E-80
sp|Q4XST6|ASNA_PLACH ATPase ASNA1 homolog OS=Plasmodium chabaudi GN=PC000665.03.0 PE=3 SV=1 14 343 3.0E-80
sp|B3L1G8|ASNA_PLAKH ATPase ASNA1 homolog OS=Plasmodium knowlesi (strain H) GN=PKH_051870 PE=3 SV=1 17 343 2.0E-79
sp|A5K5W9|ASNA_PLAVS ATPase ASNA1 homolog OS=Plasmodium vivax (strain Salvador I) GN=PVX_089705 PE=3 SV=1 17 343 3.0E-79
sp|C4LY44|ASNA_ENTHI ATPase ASNA1 homolog OS=Entamoeba histolytica GN=EHI_177400 PE=3 SV=1 16 334 9.0E-78
sp|B0EHY7|ASNA_ENTDS ATPase ASNA1 homolog OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_044870 PE=3 SV=1 16 334 1.0E-77
sp|A8B3G9|ASNA_GIAIC ATPase ASNA1 homolog OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_7953 PE=3 SV=1 15 340 7.0E-77
sp|A3FPQ6|ASNA_CRYPI ATPase ASNA1 homolog OS=Cryptosporidium parvum (strain Iowa II) GN=cgd7_4070 PE=3 SV=1 1 323 4.0E-76
sp|A4H6J5|ASNA_LEIBR ATPase ASNA1 homolog OS=Leishmania braziliensis GN=LbrM11_V2.0490 PE=3 SV=1 13 342 1.0E-75
sp|Q4QH08|ASNA_LEIMA ATPase ASNA1 homolog OS=Leishmania major GN=LmjF11.0700 PE=3 SV=1 13 342 9.0E-75
sp|A4HUY0|ASNA_LEIIN ATPase ASNA1 homolog OS=Leishmania infantum GN=LinJ11.0710 PE=3 SV=1 13 342 2.0E-74
sp|A7AW49|ASNA_BABBO ATPase ASNA1 homolog OS=Babesia bovis GN=BBOV_I001930 PE=3 SV=1 3 343 2.0E-71
sp|Q4N0J4|ASNA_THEPA ATPase ASNA1 homolog OS=Theileria parva GN=TP03_0142 PE=3 SV=1 13 344 5.0E-63
sp|O27555|ARSA_METTH Putative arsenical pump-driving ATPase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1511 PE=1 SV=1 28 344 3.0E-53
sp|Q58542|ARSA_METJA Putative arsenical pump-driving ATPase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1142 PE=1 SV=1 43 336 1.0E-49
sp|O52027|ARSA_HALSA Putative arsenical pump-driving ATPase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsA PE=2 SV=1 3 329 5.0E-31
sp|Q46465|ARSA_PROVB Putative arsenical pump-driving ATPase OS=Prosthecochloris vibrioformis PE=3 SV=1 26 334 7.0E-31
sp|Q46366|ARSA_CHLTE Putative arsenical pump-driving ATPase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT1945 PE=3 SV=2 26 334 1.0E-30
sp|O66908|ARSA1_AQUAE Putative arsenical pump-driving ATPase 1 OS=Aquifex aeolicus (strain VF5) GN=arsA1 PE=3 SV=1 26 336 5.0E-29
sp|O66674|ARSA2_AQUAE Putative arsenical pump-driving ATPase 2 OS=Aquifex aeolicus (strain VF5) GN=arsA2 PE=3 SV=1 40 336 2.0E-26
sp|Q55794|ARSA_SYNY3 Putative arsenical pump-driving ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0086 PE=3 SV=1 26 342 2.0E-26
sp|P52145|ARSA2_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=3 SV=1 28 285 3.0E-26
sp|P08690|ARSA1_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=1 SV=1 28 343 1.0E-25
sp|O50593|ARSA_ACIMA Arsenical pump-driving ATPase OS=Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU301) GN=arsA PE=3 SV=1 28 278 3.0E-24
sp|O52027|ARSA_HALSA Putative arsenical pump-driving ATPase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsA PE=2 SV=1 18 332 1.0E-22
sp|O50593|ARSA_ACIMA Arsenical pump-driving ATPase OS=Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU301) GN=arsA PE=3 SV=1 29 329 6.0E-10
sp|P52145|ARSA2_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=3 SV=1 29 329 5.0E-09
sp|P08690|ARSA1_ECOLX Arsenical pump-driving ATPase OS=Escherichia coli GN=arsA PE=1 SV=1 15 333 6.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7410 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5405
Ophiocordyceps camponoti-floridani Ophcf2|00975
Ophiocordyceps camponoti-rufipedis Ophun1|1330
Ophiocordyceps kimflemingae Ophio5|2016
Ophiocordyceps subramaniannii Hirsu2|9520

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7410
MSTAIISPDEAALEPTLQTLLDQRSLRWIFVGGKGGVGKTTTSCSLAIQLARVRRSVLLISTDPAHNLSDAFSQK
FGKEARLVNGYENLSAMEIDPNGSMQDLLAGQGEQDGGGDMAAMAGGLGGMMQDLAFAIPGIDEAMSFAEVLKQV
KSLSYETIIFDTAPTGHTLRFLQFPSVLEKALAKISQLSSQYGPLLNGFLGSNGTLPNGQNLTDMMDKLESLRST
ISEVNTQFKDAHLTTFVCVCIAEFLSLYETERMIQELTTYGIDTHTIVVNQLLFPKETSRCDQCIARRKMQKRYL
DQYEELYADDFHLVKMPLLVDEVRGKEKLEAFSELLIQPYAPPEE*
Coding >OphauG2|7410
ATGTCGACGGCAATCATTTCTCCCGACGAGGCGGCCCTAGAGCCGACGCTCCAAACCCTACTAGACCAGCGGTCG
CTCCGCTGGATCTTTGTCGGGGGCAAAGGCGGCGTGGGCAAGACAACAACATCGTGCTCTCTAGCGATTCAGCTG
GCGCGAGTGCGGCGGTCCGTCTTGCTGATTAGCACGGACCCAGCACATAACCTATCCGACGCGTTTTCGCAGAAA
TTCGGCAAGGAGGCGCGTCTGGTAAACGGCTATGAGAACCTGAGTGCCATGGAGATTGATCCCAACGGCAGTATG
CAGGACTTGCTGGCGGGGCAGGGCGAGCAGGATGGCGGAGGGGACATGGCGGCCATGGCGGGGGGGTTGGGGGGC
ATGATGCAGGATCTGGCCTTTGCGATTCCAGGCATTGACGAGGCCATGTCGTTTGCCGAAGTGCTCAAGCAAGTC
AAGTCGCTTTCGTACGAAACCATCATCTTCGACACGGCGCCCACGGGCCACACGCTGCGCTTCCTCCAATTCCCG
TCGGTGCTGGAAAAGGCGCTGGCCAAGATATCCCAACTCTCATCCCAGTACGGGCCGCTGCTCAACGGCTTCCTC
GGCTCCAACGGCACGCTCCCCAACGGCCAAAACCTGACAGACATGATGGACAAGCTGGAATCCCTCCGCTCCACC
ATATCCGAAGTCAACACCCAGTTCAAAGACGCCCACCTCACCACCTTTGTCTGCGTCTGCATCGCCGAGTTCCTC
TCCCTGTACGAAACTGAACGCATGATTCAAGAACTCACCACGTACGGCATCGACACCCACACCATTGTCGTGAAC
CAGCTCCTCTTCCCGAAGGAAACGAGCCGCTGCGACCAGTGCATCGCGCGCCGCAAAATGCAGAAACGCTACCTG
GACCAATACGAAGAGCTGTACGCAGACGACTTTCACCTGGTCAAGATGCCGCTGCTGGTGGACGAGGTGCGAGGA
AAGGAAAAGCTGGAGGCGTTTAGTGAGCTGCTTATCCAGCCCTACGCCCCGCCTGAAGAATAG
Transcript >OphauG2|7410
ATGTCGACGGCAATCATTTCTCCCGACGAGGCGGCCCTAGAGCCGACGCTCCAAACCCTACTAGACCAGCGGTCG
CTCCGCTGGATCTTTGTCGGGGGCAAAGGCGGCGTGGGCAAGACAACAACATCGTGCTCTCTAGCGATTCAGCTG
GCGCGAGTGCGGCGGTCCGTCTTGCTGATTAGCACGGACCCAGCACATAACCTATCCGACGCGTTTTCGCAGAAA
TTCGGCAAGGAGGCGCGTCTGGTAAACGGCTATGAGAACCTGAGTGCCATGGAGATTGATCCCAACGGCAGTATG
CAGGACTTGCTGGCGGGGCAGGGCGAGCAGGATGGCGGAGGGGACATGGCGGCCATGGCGGGGGGGTTGGGGGGC
ATGATGCAGGATCTGGCCTTTGCGATTCCAGGCATTGACGAGGCCATGTCGTTTGCCGAAGTGCTCAAGCAAGTC
AAGTCGCTTTCGTACGAAACCATCATCTTCGACACGGCGCCCACGGGCCACACGCTGCGCTTCCTCCAATTCCCG
TCGGTGCTGGAAAAGGCGCTGGCCAAGATATCCCAACTCTCATCCCAGTACGGGCCGCTGCTCAACGGCTTCCTC
GGCTCCAACGGCACGCTCCCCAACGGCCAAAACCTGACAGACATGATGGACAAGCTGGAATCCCTCCGCTCCACC
ATATCCGAAGTCAACACCCAGTTCAAAGACGCCCACCTCACCACCTTTGTCTGCGTCTGCATCGCCGAGTTCCTC
TCCCTGTACGAAACTGAACGCATGATTCAAGAACTCACCACGTACGGCATCGACACCCACACCATTGTCGTGAAC
CAGCTCCTCTTCCCGAAGGAAACGAGCCGCTGCGACCAGTGCATCGCGCGCCGCAAAATGCAGAAACGCTACCTG
GACCAATACGAAGAGCTGTACGCAGACGACTTTCACCTGGTCAAGATGCCGCTGCTGGTGGACGAGGTGCGAGGA
AAGGAAAAGCTGGAGGCGTTTAGTGAGCTGCTTATCCAGCCCTACGCCCCGCCTGAAGAATAG
Gene >OphauG2|7410
ATGTCGACGGCAATCATTTCTCCCGACGAGGCGGCCCTAGAGCCGACGCTCCAAACCCTACTAGACCAGCGGTCG
CTCCGCTGGATCTTTGTCGGGGGCAAAGGCGGCGTGGGCAAGACAACAACATCGTGCTCTCTAGCGATTCAGCTG
GCGCGAGTGCGGCGGTCCGTCTTGCTGATTAGCACGGACCCAGCACATAACCTATCCGACGCGTTTTCGCAGAAA
TTCGGCAAGGAGGCGCGTCTGGTAAACGGCTATGAGAACCTGAGTGCCATGGAGATTGATCCCAACGGCAGTATG
CAGGACTTGCTGGCGGGGCAGGGCGAGCAGGATGGCGGAGGGGACATGGCGGCCATGGCGGGGGGGTTGGGGGGC
ATGATGCAGGATCTGGCCTTTGCGGTGCGTTGAGAGAGAGAGAGAGTGTGTGTGTGTGTAGGAAAAGAAGGAAGG
GCTAATGTGCGTTGAACAGATTCCAGGCATTGACGAGGCCATGTCGTTTGCCGAAGTGCTCAAGCAAGTCAAGTC
GCTTTCGTACGAAACCATCATCTTCGACACGGCGCCCACGGGCCACACGCTGCGCTTCCTCCAATTCCCGTCGGT
GCTGGAAAAGGCGCTGGCCAAGATATCCCAACTCTCATCCCAGTACGGGCCGCTGCTCAACGGCTTCCTCGGCTC
CAACGGCACGCTCCCCAACGGCCAAAACCTGACAGACATGATGGACAAGCTGGAATCCCTCCGCTCCACCATATC
CGAAGTCAACACCCAGTTCAAAGACGCCCACCTCACCACCTTTGTCTGCGTCTGCATCGCCGAGTTCCTCTCCCT
GTACGAAACTGAACGCATGATTCAAGAACTCACCACGTACGGCATCGACACCCACACCATTGTCGTGAACCAGCT
CCTCTTCCCGAAGGAAACGAGCCGCTGCGACCAGTGCATCGCGCGCCGCAAAATGCAGAAACGCTACCTGGACCA
ATACGAAGAGCTGTACGCAGACGACTTTCACCTGGTCAAGATGCCGCTGCTGGTGGACGAGGTGCGAGGAAAGGA
AAAGCTGGAGGCGTTTAGTGAGCTGCTTATCCAGCCCTACGCCCCGCCTGAAGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail