Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7399
Gene name
LocationContig_858:176..3218
Strand-
Gene length (bp)3042
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08631 SPO22 Meiosis protein SPO22/ZIP4 like 2.1E-55 208 480

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0051321 meiotic cell cycle Yes
GO:0008150 biological_process No
GO:0022414 reproductive process No
GO:0007049 cell cycle No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7399 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3416
Ophiocordyceps camponoti-floridani Ophcf2|03668
Ophiocordyceps camponoti-rufipedis Ophun1|318
Ophiocordyceps kimflemingae Ophio5|765
Ophiocordyceps subramaniannii Hirsu2|4362

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7399
MAPPADPVAVGRERRLRSVIEFASELQDRLPVVDQGTAVDVLVADLGQHLQTISKLEKPSLLGLVVADSATHSKE
KHADDTAVRLLKDLEHLARNLWNLCIRIKRDGAKDGVCLERRQLLARARLFAFHAIKLGRTSRQQPRDAQPDAIY
LANMALTLAKVCINDADLDSARSVLQQAAEWVDELNQDASAATTRLEAQYLTLRMALSCKQDNLDVAEHMFHKAQ
SLVESLDAPSAETMADTLQHIGAALASRGNHVKALEWLRRAHQVLHAPSLDKLSLLGLELRMAICHYRIQSLLAI
DSPESLQEANDLVAYFESELGDKPVILHWRLDILLKSPAEVFDAEAYASTLHRMIRCFDSCQDTLNFLLHHIKEL
GDVSARLATGLLDELARQHVLPSGNVTWINKVLVRRIWMATMDSSHDDPVASLGKVLDRTYDALSRPMSPEAAGA
AHSLIWKRLEASFADKQHRVADEWCQVALHAVFGDCGEANLGKFGRKRILCALELNDAERARDAFHNMPKGAQDD
ALSRYLMFKVSLVSWDHELGCESIGQLSKSTDAARSLDMLYACIREAQEFGDKLCTLAALKAVCSGWSLDETTSS
NLPSILRCTIRLIHLTEQEDKTTTHEADFAQDTCELFEKAAEQAKLGGRDDQGNKVFTVQELHWFRKNAYNIGAT
KCCTWGLPEVMRIFDTCLVFVDCYPKDMARRDEAELALMAMRCHFVLGAALVSLARAEDRVHERLQRYREARRHV
AAFDGLMQTDQADCHDAAVAKDLLAKMSTLLVFDFEGAACLNSWEHLGGIIRKAKPCRDEAAYKAMGDCLLRSQA
PAKVVYGSMRLIINDMFELADFDSSRLAKYLRCVFQAMLPLDDALALDVFDQAVQLAREGQEV*
Coding >OphauG2|7399
ATGGCACCGCCTGCGGACCCCGTAGCTGTCGGGCGCGAACGGAGGCTGCGCAGTGTCATTGAATTCGCCTCGGAG
CTTCAAGACCGGTTGCCCGTTGTCGACCAGGGCACAGCCGTCGATGTGCTGGTGGCTGATTTGGGACAGCATTTG
CAGACAATAAGCAAGCTTGAAAAGCCCTCTTTGCTCGGCCTCGTCGTGGCGGACAGCGCTACACACAGCAAGGAG
AAGCATGCAGACGACACGGCAGTCAGACTACTCAAGGACCTGGAGCATCTGGCCCGGAACTTGTGGAACCTCTGC
ATTCGCATCAAGCGAGATGGAGCTAAAGATGGTGTTTGTCTCGAGCGCCGCCAACTGCTGGCTCGTGCGAGGCTG
TTTGCCTTCCACGCAATCAAGCTAGGCCGCACCAGCAGACAGCAGCCCAGAGACGCCCAACCGGATGCAATCTAC
CTGGCCAACATGGCCCTGACGCTGGCCAAGGTTTGTATCAATGACGCCGACTTGGACTCGGCGCGCTCGGTGCTG
CAGCAGGCAGCCGAATGGGTAGACGAGCTAAATCAAGACGCTTCTGCCGCAACGACTCGGCTCGAGGCTCAGTAC
TTGACTTTGCGCATGGCATTGTCGTGCAAACAAGACAATCTCGATGTCGCCGAGCACATGTTCCACAAGGCGCAA
AGTCTTGTCGAGAGCCTTGATGCCCCCTCGGCAGAAACCATGGCAGACACGTTGCAGCACATTGGCGCCGCCCTG
GCGTCGAGGGGCAACCACGTCAAGGCACTCGAGTGGCTCAGACGAGCCCATCAAGTTTTGCATGCCCCGAGCCTG
GATAAACTGTCTCTGCTGGGCCTAGAACTTCGAATGGCCATTTGCCACTATCGTATCCAAAGTCTCTTGGCCATT
GACTCTCCAGAGTCGCTGCAGGAAGCCAACGACCTTGTGGCGTACTTTGAGTCGGAGCTGGGCGACAAACCTGTG
ATTCTTCACTGGCGGCTCGACATTTTGCTCAAGTCTCCTGCCGAGGTGTTTGACGCAGAGGCATACGCGAGCACT
CTGCATCGCATGATACGCTGCTTCGACTCTTGCCAAGACACTCTCAACTTTCTCCTCCACCACATCAAGGAACTT
GGCGACGTGAGTGCACGACTAGCTACTGGCCTACTCGACGAATTGGCAAGGCAGCATGTCTTGCCCTCTGGAAAT
GTGACGTGGATCAACAAGGTGCTAGTCAGGAGGATATGGATGGCCACTATGGATTCGAGCCACGACGACCCAGTT
GCCAGTCTCGGCAAGGTGCTGGATCGTACGTACGATGCTCTTTCGCGGCCCATGAGCCCAGAGGCGGCGGGAGCG
GCACACTCACTCATTTGGAAAAGACTCGAGGCTAGTTTTGCAGACAAGCAGCATAGAGTCGCAGACGAATGGTGT
CAGGTCGCGCTCCATGCAGTCTTTGGCGACTGCGGCGAGGCAAATTTGGGCAAGTTTGGAAGAAAAAGAATTCTC
TGTGCTCTCGAGCTAAACGACGCGGAACGAGCCCGAGATGCTTTTCACAACATGCCCAAGGGCGCACAAGACGAT
GCCCTGAGCCGATATCTCATGTTCAAAGTGTCTCTTGTCAGCTGGGACCACGAGCTTGGGTGTGAGAGCATTGGC
CAGCTCAGCAAGTCAACAGACGCGGCCAGGAGTCTGGATATGCTGTATGCCTGTATCCGGGAAGCACAAGAATTT
GGAGACAAGCTGTGTACTCTAGCGGCGCTCAAGGCGGTCTGCAGCGGCTGGTCTTTGGACGAGACGACGTCGAGC
AACCTGCCATCGATACTGCGCTGCACCATACGGCTGATTCACCTGACAGAGCAAGAGGACAAGACGACGACACAC
GAGGCGGATTTCGCACAGGACACGTGCGAGTTGTTTGAAAAAGCTGCCGAACAGGCGAAACTGGGCGGCAGAGAC
GACCAAGGAAACAAGGTGTTTACGGTGCAGGAGCTCCACTGGTTTCGGAAGAATGCCTACAATATTGGTGCAACA
AAGTGTTGCACCTGGGGGCTGCCCGAGGTGATGCGCATCTTTGACACGTGTTTGGTCTTTGTCGACTGCTATCCC
AAGGACATGGCGCGCCGCGACGAGGCCGAGCTGGCACTCATGGCCATGCGCTGCCACTTTGTCCTGGGCGCTGCT
CTGGTCTCACTTGCACGGGCAGAGGACAGGGTGCATGAGCGACTACAGCGTTACCGCGAGGCGAGGCGTCACGTT
GCAGCCTTTGACGGCCTGATGCAGACGGACCAGGCCGACTGCCACGACGCAGCCGTGGCCAAGGATTTGCTGGCC
AAGATGTCGACGCTGCTAGTCTTTGACTTTGAAGGCGCAGCATGTCTCAACAGTTGGGAGCACCTCGGCGGCATC
ATCCGCAAGGCCAAGCCCTGCCGGGACGAGGCAGCCTATAAGGCAATGGGCGACTGCCTGCTCAGGAGCCAGGCC
CCTGCAAAAGTGGTGTATGGAAGCATGAGGCTCATCATTAATGACATGTTTGAGCTGGCCGACTTTGACAGCTCA
AGACTGGCCAAGTATCTGCGGTGCGTGTTTCAGGCCATGCTGCCTCTGGACGACGCGCTGGCACTGGACGTTTTT
GACCAGGCCGTGCAACTGGCGCGGGAGGGACAAGAGGTGTAG
Transcript >OphauG2|7399
ATGGCACCGCCTGCGGACCCCGTAGCTGTCGGGCGCGAACGGAGGCTGCGCAGTGTCATTGAATTCGCCTCGGAG
CTTCAAGACCGGTTGCCCGTTGTCGACCAGGGCACAGCCGTCGATGTGCTGGTGGCTGATTTGGGACAGCATTTG
CAGACAATAAGCAAGCTTGAAAAGCCCTCTTTGCTCGGCCTCGTCGTGGCGGACAGCGCTACACACAGCAAGGAG
AAGCATGCAGACGACACGGCAGTCAGACTACTCAAGGACCTGGAGCATCTGGCCCGGAACTTGTGGAACCTCTGC
ATTCGCATCAAGCGAGATGGAGCTAAAGATGGTGTTTGTCTCGAGCGCCGCCAACTGCTGGCTCGTGCGAGGCTG
TTTGCCTTCCACGCAATCAAGCTAGGCCGCACCAGCAGACAGCAGCCCAGAGACGCCCAACCGGATGCAATCTAC
CTGGCCAACATGGCCCTGACGCTGGCCAAGGTTTGTATCAATGACGCCGACTTGGACTCGGCGCGCTCGGTGCTG
CAGCAGGCAGCCGAATGGGTAGACGAGCTAAATCAAGACGCTTCTGCCGCAACGACTCGGCTCGAGGCTCAGTAC
TTGACTTTGCGCATGGCATTGTCGTGCAAACAAGACAATCTCGATGTCGCCGAGCACATGTTCCACAAGGCGCAA
AGTCTTGTCGAGAGCCTTGATGCCCCCTCGGCAGAAACCATGGCAGACACGTTGCAGCACATTGGCGCCGCCCTG
GCGTCGAGGGGCAACCACGTCAAGGCACTCGAGTGGCTCAGACGAGCCCATCAAGTTTTGCATGCCCCGAGCCTG
GATAAACTGTCTCTGCTGGGCCTAGAACTTCGAATGGCCATTTGCCACTATCGTATCCAAAGTCTCTTGGCCATT
GACTCTCCAGAGTCGCTGCAGGAAGCCAACGACCTTGTGGCGTACTTTGAGTCGGAGCTGGGCGACAAACCTGTG
ATTCTTCACTGGCGGCTCGACATTTTGCTCAAGTCTCCTGCCGAGGTGTTTGACGCAGAGGCATACGCGAGCACT
CTGCATCGCATGATACGCTGCTTCGACTCTTGCCAAGACACTCTCAACTTTCTCCTCCACCACATCAAGGAACTT
GGCGACGTGAGTGCACGACTAGCTACTGGCCTACTCGACGAATTGGCAAGGCAGCATGTCTTGCCCTCTGGAAAT
GTGACGTGGATCAACAAGGTGCTAGTCAGGAGGATATGGATGGCCACTATGGATTCGAGCCACGACGACCCAGTT
GCCAGTCTCGGCAAGGTGCTGGATCGTACGTACGATGCTCTTTCGCGGCCCATGAGCCCAGAGGCGGCGGGAGCG
GCACACTCACTCATTTGGAAAAGACTCGAGGCTAGTTTTGCAGACAAGCAGCATAGAGTCGCAGACGAATGGTGT
CAGGTCGCGCTCCATGCAGTCTTTGGCGACTGCGGCGAGGCAAATTTGGGCAAGTTTGGAAGAAAAAGAATTCTC
TGTGCTCTCGAGCTAAACGACGCGGAACGAGCCCGAGATGCTTTTCACAACATGCCCAAGGGCGCACAAGACGAT
GCCCTGAGCCGATATCTCATGTTCAAAGTGTCTCTTGTCAGCTGGGACCACGAGCTTGGGTGTGAGAGCATTGGC
CAGCTCAGCAAGTCAACAGACGCGGCCAGGAGTCTGGATATGCTGTATGCCTGTATCCGGGAAGCACAAGAATTT
GGAGACAAGCTGTGTACTCTAGCGGCGCTCAAGGCGGTCTGCAGCGGCTGGTCTTTGGACGAGACGACGTCGAGC
AACCTGCCATCGATACTGCGCTGCACCATACGGCTGATTCACCTGACAGAGCAAGAGGACAAGACGACGACACAC
GAGGCGGATTTCGCACAGGACACGTGCGAGTTGTTTGAAAAAGCTGCCGAACAGGCGAAACTGGGCGGCAGAGAC
GACCAAGGAAACAAGGTGTTTACGGTGCAGGAGCTCCACTGGTTTCGGAAGAATGCCTACAATATTGGTGCAACA
AAGTGTTGCACCTGGGGGCTGCCCGAGGTGATGCGCATCTTTGACACGTGTTTGGTCTTTGTCGACTGCTATCCC
AAGGACATGGCGCGCCGCGACGAGGCCGAGCTGGCACTCATGGCCATGCGCTGCCACTTTGTCCTGGGCGCTGCT
CTGGTCTCACTTGCACGGGCAGAGGACAGGGTGCATGAGCGACTACAGCGTTACCGCGAGGCGAGGCGTCACGTT
GCAGCCTTTGACGGCCTGATGCAGACGGACCAGGCCGACTGCCACGACGCAGCCGTGGCCAAGGATTTGCTGGCC
AAGATGTCGACGCTGCTAGTCTTTGACTTTGAAGGCGCAGCATGTCTCAACAGTTGGGAGCACCTCGGCGGCATC
ATCCGCAAGGCCAAGCCCTGCCGGGACGAGGCAGCCTATAAGGCAATGGGCGACTGCCTGCTCAGGAGCCAGGCC
CCTGCAAAAGTGGTGTATGGAAGCATGAGGCTCATCATTAATGACATGTTTGAGCTGGCCGACTTTGACAGCTCA
AGACTGGCCAAGTATCTGCGGTGCGTGTTTCAGGCCATGCTGCCTCTGGACGACGCGCTGGCACTGGACGTTTTT
GACCAGGCCGTGCAACTGGCGCGGGAGGGACAAGAGGTGTAG
Gene >OphauG2|7399
ATGGCACCGCCTGCGGACCCCGTAGCTGTCGGGCGCGAACGGAGGCTGCGCAGTGTCATTGGTGAGACGAGAGCC
ACGGAGCGCCCATGCGACTTGTCCTCTCCGGCTTCTGACCGTGGTGTTTTCTGCCATTAGAATTCGCCTCGGAGC
TTCAAGACCGGTTGCCCGTTGTCGACCAGGGCACAGCCGTCGATGTGCTGGTGGCTGATTTGGGACAGCATTTGC
AGACAATAAGCAAGCTTGAAAAGCCCTCTTTGCTCGGCCTCGTCGTGGCGGACAGCGCTACACACAGCAAGGAGA
AGCATGCAGACGACACGGCAGTCAGACTACTCAAGGACCTGGAGCATCTGGCCCGGAACTTGTGGAACCTCTGCA
TTCGCATCAAGCGAGATGGAGCTAAAGATGGTGTTTGTCTCGAGCGCCGCCAACTGCTGGCTCGTGCGAGGCTGT
TTGCCTTCCACGCAATCAAGCTAGGCCGCACCAGCAGACAGCAGCCCAGAGACGCCCAACCGGATGCAATCTACC
TGGCCAACATGGCCCTGACGCTGGCCAAGGTTTGTATCAATGACGCCGACTTGGACTCGGCGCGCTCGGTGCTGC
AGCAGGCAGCCGAATGGGTAGACGAGCTAAATCAAGACGCTTCTGCCGCAACGACTCGGCTCGAGGCTCAGTACT
TGACTTTGCGCATGGCATTGGTAAGCCCCCCCGCCCGCCATTACCCGTTGGCATTGGTGATGATGACAAGGTGGT
GAGTCGTGCAAACAAGACAATCTCGATGTCGCCGAGCACATGTTCCACAAGGCGCAAAGTCTTGTCGAGAGCCTT
GATGCCCCCTCGGCAGAAACCATGGCAGACACGTTGCAGCACATTGGCGCCGCCCTGGCGTCGAGGGGCAACCAC
GTCAAGGCACTCGAGTGGCTCAGACGAGCCCATCAAGTTTTGCATGCCCCGAGCCTGGATAAACTGTCTCTGCTG
GGCCTAGAACTTCGAATGGCCATTTGCCACTATCGTATCCAAAGTCTCTTGGCCATTGACTCTCCAGAGTCGCTG
CAGGAAGCCAACGACCTTGTGGCGTACTTTGAGTCGGAGCTGGGCGACAAACCTGTGATTCTTCACTGGCGGCTC
GACATTTTGCTCAAGTCTCCTGCCGAGGTGTTTGACGCAGAGGCATACGCGAGCACTCTGCATCGCATGATACGC
TGCTTCGACTCTTGCCAAGACACTCTCAACTTTCTCCTCCACCACATCAAGGAACTTGGCGACGTGAGTGCACGA
CTAGCTACTGGCCTACTCGACGAATTGGCAAGGCAGCATGTCTTGCCCTCTGGAAATGTGACGTGGATCAACAAG
GTGCTAGTCAGGAGGATATGGATGGCCACTATGGATTCGAGCCACGACGACCCAGTTGCCAGTCTCGGCAAGGTG
CTGGATCGTACGTACGATGCTCTTTCGCGGCCCATGAGCCCAGAGGCGGCGGGAGCGGCACACTCAGTAAGGTGG
AATCAAAAGACGACGTGAAATCCAATTCGGACTTCTGACTGGCCTTGGCAGCTCATTTGGAAAAGACTCGAGGCT
AGTTTTGCAGACAAGCAGCATAGAGTCGCAGACGAATGGTGTCAGGTCGCGCTCCATGCAGTCTTTGGCGACTGC
GGCGAGGCAAATTTGGGCAAGTTTGGAAGAAAAAGAATTCTCTGTGCTCTCGAGCTAAACGACGCGGAACGAGCC
CGAGATGCTTTTCACAACATGCCCAAGGGCGCACAAGACGATGCCCTGAGCCGATATCTCATGTTCAAAGTGTCT
CTTGTCAGCTGGGACCACGAGCTTGGGTGTGAGAGCATTGGCCAGCTCAGCAAGTCAACAGACGCGGCCAGGAGT
CTGGATATGCTGTATGCCTGTATCCGGGAAGCACAAGAATTTGGAGACAAGCTGTGTACTCTAGCGGCGCTCAAG
GCGGTCTGCAGCGGCTGGTCTTTGGACGAGACGACGTCGAGCAACCTGCCATCGATACTGCGCTGCACCATACGG
CTGATTCACCTGACAGAGCAAGAGGACAAGACGACGACACACGAGGCGGATTTCGCACAGGACACGTGCGAGTTG
TTTGAAAAAGGTGTCGTGGTAGCGGTCCCCCCTGTGCAAGACGGATTTGCATGCTGACTCGGCCAGCTGCCGAAC
AGGCGAAACTGGGCGGCAGAGACGACCAAGGAAACAAGGTGTTTACGGTGCAGGAGCTCCACTGGTTTCGGAAGA
ATGCCTACAATATTGGTGCAACAAAGTGTTGCACCTGGGGGCTGCCCGAGGTGATGCGCATCTTTGACACGTGTT
TGGTCTTTGTCGACTGCTATCCCAAGGACATGGCGCGCCGCGACGAGGCCGAGCTGGCACTCATGGCCATGCGCT
GCCACTTTGTCCTGGGCGCTGCTCTGGTCTCACTTGCACGGGCAGAGGACAGGGTGCATGAGCGACTACAGCGTT
ACCGCGAGGCGAGGCGTCACGTTGCAGCCTTTGACGGCCTGATGCAGACGGACCAGGCCGACTGCCACGACGCAG
CCGTGGCCAAGGATTTGCTGGCCAAGATGTCGACGCTGCTAGTCTTTGACTTTGAAGGCGCAGCATGTCTCAACA
GTTGGGAGCACCTCGGCGGCATCATCCGCAAGGCCAAGCCCTGCCGGGACGAGGCAGCCTATAAGGCAATGGGCG
ACTGCCTGCTCAGGAGCCAGGCCCCTGCAAAAGGTGCGTTGGGCTGGGAGAGAGCAAGTGTACCCAAGGCCTCCC
CCCCCCTCTGTGATTGTGGCATGCAGGGCGTAAGCTGACGGCAGCTGCCAAATTGTTGTTGTTGTTGTTTGTCTT
GGGGCTTAAGTGGTGTATGGAAGCATGAGGCTCATCATTAATGACATGTTTGAGCTGGCCGACTTTGACAGCTCA
AGACTGGCCAAGTATCTGCGGTGCGTGTTTCAGGCCATGCTGCCTCTGGACGACGCGCTGGCACTGGACGTTTTT
GACCAGGCCGTGCAACTGGCGCGGGAGGGACAAGAGGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail