Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|737
Gene name
LocationContig_119:22802..23478
Strand-
Gene length (bp)676
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10273 WGG Pre-rRNA-processing protein TSR2 1.4E-34 20 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06672|TSR2_YEAST Pre-rRNA-processing protein TSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR2 PE=1 SV=2 16 205 7.0E-23
sp|Q9UUA9|TSR2_SCHPO Pre-rRNA-processing protein tsr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr2 PE=3 SV=1 16 205 2.0E-12
sp|Q3KRG3|TSR2_DANRE Pre-rRNA-processing protein TSR2 homolog OS=Danio rerio GN=tsr2 PE=2 SV=1 11 204 4.0E-11
sp|Q8C8T8|TSR2_MOUSE Pre-rRNA-processing protein TSR2 homolog OS=Mus musculus GN=Tsr2 PE=1 SV=1 20 204 5.0E-11
sp|Q3T090|TSR2_BOVIN Pre-rRNA-processing protein TSR2 homolog OS=Bos taurus GN=TSR2 PE=2 SV=1 20 204 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06672|TSR2_YEAST Pre-rRNA-processing protein TSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR2 PE=1 SV=2 16 205 7.0E-23
sp|Q9UUA9|TSR2_SCHPO Pre-rRNA-processing protein tsr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr2 PE=3 SV=1 16 205 2.0E-12
sp|Q3KRG3|TSR2_DANRE Pre-rRNA-processing protein TSR2 homolog OS=Danio rerio GN=tsr2 PE=2 SV=1 11 204 4.0E-11
sp|Q8C8T8|TSR2_MOUSE Pre-rRNA-processing protein TSR2 homolog OS=Mus musculus GN=Tsr2 PE=1 SV=1 20 204 5.0E-11
sp|Q3T090|TSR2_BOVIN Pre-rRNA-processing protein TSR2 homolog OS=Bos taurus GN=TSR2 PE=2 SV=1 20 204 5.0E-10
sp|Q3KPN2|TSR2_XENLA Pre-rRNA-processing protein TSR2 homolog OS=Xenopus laevis GN=tsr2 PE=2 SV=2 20 122 8.0E-10
sp|Q969E8|TSR2_HUMAN Pre-rRNA-processing protein TSR2 homolog OS=Homo sapiens GN=TSR2 PE=1 SV=1 20 111 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|737
MASSDEPPVLPRATVRQSNFEQSVVYALHLWPALTLAVTNSWGGPDSSDKRDWFAGAIVDLFPAFIDVSAASSAS
NEPDIEHVETVLLQVMLDEFEVNVDDDSAAEVAAQIIRSRSQCALGHFDHVIVLRERFLTRNGHKVDHLFHKAQD
ADQDTDWESDDDDDDAQDDEENADVAMLDAPPVHKEKPLPQVDQDGFTMVTKKKR*
Coding >OphauG2|737
ATGGCTTCCTCAGACGAGCCTCCCGTGCTGCCCCGAGCCACTGTGCGCCAGTCCAATTTTGAGCAAAGTGTCGTC
TACGCTCTACATCTCTGGCCCGCTCTTACCCTCGCCGTGACAAATTCTTGGGGAGGCCCCGACTCTTCTGACAAG
CGCGACTGGTTTGCCGGCGCCATTGTCGACCTGTTTCCTGCCTTTATCGATGTTTCTGCCGCTTCCTCGGCCTCC
AATGAACCAGATATTGAGCACGTCGAGACCGTCCTGCTGCAGGTCATGTTGGACGAATTCGAGGTCAATGTTGAC
GACGACTCGGCTGCAGAAGTCGCAGCCCAGATTATTCGTTCCCGCTCTCAATGCGCTCTGGGCCATTTCGACCAC
GTCATTGTCCTCAGGGAGCGCTTCCTAACCCGTAATGGACACAAGGTCGACCACTTGTTCCACAAGGCCCAAGAT
GCTGATCAAGACACCGATTGGGAGTCTGACGACGACGACGACGACGCTCAAGATGACGAGGAAAATGCAGATGTA
GCAATGCTTGACGCGCCTCCTGTACATAAAGAGAAGCCGCTACCCCAAGTCGATCAAGATGGCTTCACAATGGTC
ACCAAGAAGAAGCGATAG
Transcript >OphauG2|737
ATGGCTTCCTCAGACGAGCCTCCCGTGCTGCCCCGAGCCACTGTGCGCCAGTCCAATTTTGAGCAAAGTGTCGTC
TACGCTCTACATCTCTGGCCCGCTCTTACCCTCGCCGTGACAAATTCTTGGGGAGGCCCCGACTCTTCTGACAAG
CGCGACTGGTTTGCCGGCGCCATTGTCGACCTGTTTCCTGCCTTTATCGATGTTTCTGCCGCTTCCTCGGCCTCC
AATGAACCAGATATTGAGCACGTCGAGACCGTCCTGCTGCAGGTCATGTTGGACGAATTCGAGGTCAATGTTGAC
GACGACTCGGCTGCAGAAGTCGCAGCCCAGATTATTCGTTCCCGCTCTCAATGCGCTCTGGGCCATTTCGACCAC
GTCATTGTCCTCAGGGAGCGCTTCCTAACCCGTAATGGACACAAGGTCGACCACTTGTTCCACAAGGCCCAAGAT
GCTGATCAAGACACCGATTGGGAGTCTGACGACGACGACGACGACGCTCAAGATGACGAGGAAAATGCAGATGTA
GCAATGCTTGACGCGCCTCCTGTACATAAAGAGAAGCCGCTACCCCAAGTCGATCAAGATGGCTTCACAATGGTC
ACCAAGAAGAAGCGATAG
Gene >OphauG2|737
ATGGCTTCCTCAGACGAGCCTCCCGTGCTGCCCCGAGCCAGTACGCATCTCCTCGTCATGTCGTCGCCCCCGTCT
TCATCTAACCAATCATCAATCAGCTGTGCGCCAGTCCAATTTTGAGCAAAGTGTCGTCTACGCTCTACATCTCTG
GCCCGCTCTTACCCTCGCCGTGACAAATTCTTGGGGAGGCCCCGACTCTTCTGACAAGCGCGACTGGTTTGCCGG
CGCCATTGTCGACCTGTTTCCTGCCTTTATCGATGTTTCTGCCGCTTCCTCGGCCTCCAATGAACCAGATATTGA
GCACGTCGAGACCGTCCTGCTGCAGGTCATGTTGGACGAATTCGAGGTCAATGTTGACGACGACTCGGCTGCAGA
AGTCGCAGCCCAGATTATTCGTTCCCGCTCTCAATGCGCTCTGGGCCATTTCGACCACGTCATTGTCCTCAGGGA
GCGCTTCCTAACCCGTAATGGACACAAGGTCGACCACTTGTTCCACAAGGCCCAAGATGCTGATCAAGACACCGA
TTGGGAGTCTGACGACGACGACGACGACGCTCAAGATGACGAGGAAAATGCAGATGTAGCAATGCTTGACGCGCC
TCCTGTACATAAAGAGAAGCCGCTACCCCAAGTCGATCAAGATGGCTTCACAATGGTCACCAAGAAGAAGCGATA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail