Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7367
Gene name
LocationContig_85:83..1077
Strand+
Gene length (bp)994
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02301 HORMA HORMA domain 9.7E-35 24 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14417|MAD2_SCHPO Mitotic spindle checkpoint component mad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad2 PE=1 SV=1 19 226 9.0E-78
sp|P40958|MAD2_YEAST Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAD2 PE=1 SV=1 19 224 1.0E-63
sp|Q556Y9|MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum GN=mad2l1-1 PE=3 SV=1 19 227 8.0E-63
sp|Q13257|MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens GN=MAD2L1 PE=1 SV=1 14 225 1.0E-59
sp|Q9Z1B5|MD2L1_MOUSE Mitotic spindle assembly checkpoint protein MAD2A OS=Mus musculus GN=Mad2l1 PE=1 SV=2 19 224 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14417|MAD2_SCHPO Mitotic spindle checkpoint component mad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad2 PE=1 SV=1 19 226 9.0E-78
sp|P40958|MAD2_YEAST Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAD2 PE=1 SV=1 19 224 1.0E-63
sp|Q556Y9|MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum GN=mad2l1-1 PE=3 SV=1 19 227 8.0E-63
sp|Q13257|MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens GN=MAD2L1 PE=1 SV=1 14 225 1.0E-59
sp|Q9Z1B5|MD2L1_MOUSE Mitotic spindle assembly checkpoint protein MAD2A OS=Mus musculus GN=Mad2l1 PE=1 SV=2 19 224 2.0E-58
sp|Q9LU93|MAD2_ARATH Mitotic spindle checkpoint protein MAD2 OS=Arabidopsis thaliana GN=MAD2 PE=1 SV=1 1 224 8.0E-57
sp|Q59VQ3|MAD2_CANAL Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAD2 PE=3 SV=1 18 224 6.0E-52
sp|Q9XFH3|MAD2_MAIZE Mitotic spindle checkpoint protein MAD2 OS=Zea mays GN=MAD2 PE=2 SV=1 1 224 9.0E-52
sp|Q568H3|MD2L2_DANRE Mitotic spindle assembly checkpoint protein MAD2B OS=Danio rerio GN=mad2l2 PE=2 SV=1 27 181 1.0E-08
sp|Q2KIP7|MD2L2_BOVIN Mitotic spindle assembly checkpoint protein MAD2B OS=Bos taurus GN=MAD2L2 PE=2 SV=1 27 181 1.0E-08
sp|D3Z8D9|MD2L2_RAT Mitotic spindle assembly checkpoint protein MAD2B OS=Rattus norvegicus GN=Mad2l2 PE=2 SV=1 27 181 2.0E-08
sp|Q9D752|MD2L2_MOUSE Mitotic spindle assembly checkpoint protein MAD2B OS=Mus musculus GN=Mad2l2 PE=1 SV=2 27 181 2.0E-08
sp|Q8QFR4|MD2L2_XENLA Mitotic spindle assembly checkpoint protein MAD2B OS=Xenopus laevis GN=mad2l2 PE=1 SV=1 27 118 1.0E-07
sp|Q4KWZ6|MD2L2_CHICK Mitotic spindle assembly checkpoint protein MAD2B OS=Gallus gallus GN=MAD2L2 PE=1 SV=1 27 181 2.0E-07
sp|Q9UI95|MD2L2_HUMAN Mitotic spindle assembly checkpoint protein MAD2B OS=Homo sapiens GN=MAD2L2 PE=1 SV=2 27 181 2.0E-07
sp|Q28H85|MD2L2_XENTR Mitotic spindle assembly checkpoint protein MAD2B OS=Xenopus tropicalis GN=mad2l2 PE=2 SV=1 27 118 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7367
MASKEASSKDKDKSKVHKLSLKGSSRLVAEFFHYSIHNILFQRGVYPAEDFTAVKKYGLNMLVSADDQVKAYIKR
IMSQLDKWMVGGKISKLVIVISDKDTGEHVERWQFDVQISQPPKKSKSKPSTANQENTTPSAPPEAEKTEAEIQA
EIAAIFRQITASVTFLPQLAGNCTFNVLVYADADSDVPVEWGDSDPKEIVNGEHVQLRGFSTASHRVDTIVSYRL
GD*
Coding >OphauG2|7367
ATGGCATCAAAAGAGGCTTCGTCCAAAGACAAGGACAAGTCAAAAGTCCATAAATTGTCCCTCAAGGGCAGTTCC
CGCCTCGTCGCAGAATTCTTTCATTATTCTATTCACAACATCTTATTCCAGCGCGGCGTCTATCCCGCTGAAGAT
TTTACGGCAGTCAAGAAATATGGCCTCAACATGCTCGTCTCGGCCGACGACCAGGTCAAGGCTTACATCAAAAGA
ATAATGTCCCAGCTCGACAAATGGATGGTTGGCGGCAAAATCTCAAAGCTCGTCATTGTCATCTCAGACAAAGAT
ACGGGTGAACACGTTGAACGGTGGCAATTCGACGTGCAAATCTCGCAACCACCAAAAAAGTCCAAGTCCAAGCCC
TCGACCGCCAACCAAGAAAACACCACTCCCAGTGCTCCTCCCGAGGCCGAAAAGACCGAGGCCGAGATCCAGGCC
GAGATTGCCGCCATTTTCCGCCAAATCACAGCCTCGGTTACCTTTCTTCCCCAACTCGCCGGCAACTGCACCTTC
AATGTTCTCGTCTATGCAGATGCCGACTCAGACGTGCCCGTTGAGTGGGGGGACTCGGATCCAAAGGAGATTGTA
AATGGCGAGCACGTCCAGCTGCGAGGCTTTAGCACTGCCAGCCACCGCGTTGATACTATTGTTAGCTACAGGCTG
GGGGATTGA
Transcript >OphauG2|7367
ATGGCATCAAAAGAGGCTTCGTCCAAAGACAAGGACAAGTCAAAAGTCCATAAATTGTCCCTCAAGGGCAGTTCC
CGCCTCGTCGCAGAATTCTTTCATTATTCTATTCACAACATCTTATTCCAGCGCGGCGTCTATCCCGCTGAAGAT
TTTACGGCAGTCAAGAAATATGGCCTCAACATGCTCGTCTCGGCCGACGACCAGGTCAAGGCTTACATCAAAAGA
ATAATGTCCCAGCTCGACAAATGGATGGTTGGCGGCAAAATCTCAAAGCTCGTCATTGTCATCTCAGACAAAGAT
ACGGGTGAACACGTTGAACGGTGGCAATTCGACGTGCAAATCTCGCAACCACCAAAAAAGTCCAAGTCCAAGCCC
TCGACCGCCAACCAAGAAAACACCACTCCCAGTGCTCCTCCCGAGGCCGAAAAGACCGAGGCCGAGATCCAGGCC
GAGATTGCCGCCATTTTCCGCCAAATCACAGCCTCGGTTACCTTTCTTCCCCAACTCGCCGGCAACTGCACCTTC
AATGTTCTCGTCTATGCAGATGCCGACTCAGACGTGCCCGTTGAGTGGGGGGACTCGGATCCAAAGGAGATTGTA
AATGGCGAGCACGTCCAGCTGCGAGGCTTTAGCACTGCCAGCCACCGCGTTGATACTATTGTTAGCTACAGGCTG
GGGGATTGA
Gene >OphauG2|7367
ATGGCATCAAAAGAGGCTTCGTCCAAAGACAAGGACAAGTCAAAAGTCCATAAATTGTCCCTCAAGGGCAGTTCC
CGCCTCGTCGCAGAATTCGTCCGTCTCCCACCTCTCTCTGCTCCCATTGGTACATATGACTAATGCTTTGCATCG
CATTCGCAGTTTCATTATTCTATTCACAACATCTTGTGCGTCTGCGTCCTGATGGCTTGGCTTGGCCGCTTTGAG
ACTGATGCTCAAGGTAATGCAGATTCCAGCGCGGCGTCTATCCCGCTGAAGATTTTACGGCGTAGGCCTCTCACT
TCATATCTGGCCCCGCGCGCGCTGTTGCTCTGGCTTTGATGAGCTGATTGGACGATAGAGTCAAGAAATATGGCC
TCAACATGCTCGGTACGCGTCTCGTTGCTCCCCTACCCGTGCCCAAAGCCAACAAATACTGACAGCGCGCTAGTC
TCGGCCGACGACCAGGTCAAGGCTTACATCAAAAGAATAATGTCCCAGCTCGACAAATGGATGGTTGGCGGCAAA
ATCTCAAAGCTCGTCATTGTCATCTCAGACAAAGATACGGGTGAACACGTTGAACGGTGGCAATTCGACGTATGT
TCGTCCCTAGCCTGCAACAGCGAACCAAACTTATGCCACCCAGGTGCAAATCTCGCAACCACCAAAAAAGTCCAA
GTCCAAGCCCTCGACCGCCAACCAAGAAAACACCACTCCCAGTGCTCCTCCCGAGGCCGAAAAGACCGAGGCCGA
GATCCAGGCCGAGATTGCCGCCATTTTCCGCCAAATCACAGCCTCGGTTACCTTTCTTCCCCAACTCGCCGGCAA
CTGCACCTTCAATGTTCTCGTCTATGCAGATGCCGACTCAGACGTGCCCGTTGAGTGGGGGGACTCGGATCCAAA
GGAGATTGTAAATGGCGAGCACGTCCAGCTGCGAGGCTTTAGCACTGCCAGCCACCGCGTTGATACTATTGTTAG
CTACAGGCTGGGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail