Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|736
Gene name
LocationContig_119:21273..22603
Strand+
Gene length (bp)1330
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03909 BSD BSD domain 2.8E-19 240 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13905|YF3E_SCHPO BSD domain-containing protein C22A12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.14c PE=1 SV=1 153 340 4.0E-14
sp|A2BIJ3|BSDC1_DANRE BSD domain-containing protein 1 OS=Danio rerio GN=bsdc1 PE=1 SV=1 137 301 1.0E-09
sp|Q5ZIK6|BSDC1_CHICK BSD domain-containing protein 1 OS=Gallus gallus GN=BSDC1 PE=2 SV=1 173 301 2.0E-07
sp|Q80Y55|BSDC1_MOUSE BSD domain-containing protein 1 OS=Mus musculus GN=Bsdc1 PE=1 SV=1 216 301 3.0E-07
sp|Q6NTW1|BSC1B_XENLA BSD domain-containing protein 1-B OS=Xenopus laevis GN=bsdc1-b PE=2 SV=1 174 301 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13905|YF3E_SCHPO BSD domain-containing protein C22A12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.14c PE=1 SV=1 153 340 4.0E-14
sp|A2BIJ3|BSDC1_DANRE BSD domain-containing protein 1 OS=Danio rerio GN=bsdc1 PE=1 SV=1 137 301 1.0E-09
sp|Q5ZIK6|BSDC1_CHICK BSD domain-containing protein 1 OS=Gallus gallus GN=BSDC1 PE=2 SV=1 173 301 2.0E-07
sp|Q80Y55|BSDC1_MOUSE BSD domain-containing protein 1 OS=Mus musculus GN=Bsdc1 PE=1 SV=1 216 301 3.0E-07
sp|Q6NTW1|BSC1B_XENLA BSD domain-containing protein 1-B OS=Xenopus laevis GN=bsdc1-b PE=2 SV=1 174 301 4.0E-07
sp|Q9NW68|BSDC1_HUMAN BSD domain-containing protein 1 OS=Homo sapiens GN=BSDC1 PE=1 SV=1 216 301 6.0E-07
sp|Q3SX22|BSDC1_BOVIN BSD domain-containing protein 1 OS=Bos taurus GN=BSDC1 PE=2 SV=1 216 301 8.0E-07
sp|Q6INU2|BSC1A_XENLA BSD domain-containing protein 1-A OS=Xenopus laevis GN=bsdc1-a PE=2 SV=1 216 301 1.0E-06
sp|Q5BJ78|BSDC1_XENTR BSD domain-containing protein 1 OS=Xenopus tropicalis GN=bsdc1 PE=2 SV=1 161 301 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|736
MDLAYDHIQEDAYYKDNASSSDTPKPEQQSSLNTDLQDAYKAISSSPWGLKIGGFLGNVVKQGESVYNQAQKELA
EVGEDASRGFTDLRESLITRTRALSLHTSPEQKAPGEAGEGEDASSTPTRSTAPPTEDAAQQHETVLSRLRSEAT
KRLKDLQKAEDAADEALLRFGGNVRDFLRDAISIAPPDESSQNSDVLFESKDALGKRVIHTSRFDAQLHVIHTSA
DRLSEDPPGPEYKKWGDDFDIDQKTKNISSDLAQYPELRDTMEKLVPEKVPYADFWRRYYFLRHGIETAESRRRD
LLNAASADDEVSWDDDSDDDSGPGKEAGTQKTASVASSTTLHPKGQASTKTVEARKSNDEKSQADSEASYDVVGA
TSGKTSQAPSSPKDVKKDDDSDEDWE*
Coding >OphauG2|736
ATGGACCTTGCATATGACCACATCCAGGAGGATGCTTATTACAAGGATAACGCCTCGTCTAGCGATACCCCCAAG
CCTGAGCAGCAGTCGTCGCTCAACACCGACTTGCAAGACGCCTACAAGGCCATTAGCTCCAGTCCCTGGGGCCTC
AAAATTGGCGGCTTTCTCGGCAACGTCGTGAAGCAGGGCGAGTCAGTCTATAACCAAGCTCAAAAGGAATTGGCC
GAGGTCGGCGAGGATGCATCCAGAGGCTTCACTGATTTGCGTGAATCGCTCATAACTCGAACTCGAGCTCTATCT
CTCCATACGTCCCCGGAGCAAAAGGCTCCTGGTGAGGCTGGTGAGGGAGAGGATGCATCTTCGACGCCCACCCGG
TCCACCGCTCCTCCAACAGAAGACGCTGCACAGCAACATGAGACTGTCCTCTCTAGGCTACGAAGCGAGGCCACC
AAACGACTCAAAGATCTTCAAAAAGCCGAAGATGCTGCTGACGAGGCGCTATTAAGATTTGGCGGCAACGTGCGC
GATTTCTTGCGCGACGCCATCAGTATTGCCCCGCCCGACGAATCCTCACAGAATAGCGACGTCTTATTTGAGAGC
AAGGATGCGCTTGGGAAACGTGTCATTCACACTTCGAGGTTTGATGCGCAGTTGCATGTGATCCACACGTCGGCA
GACCGTCTATCGGAAGATCCTCCTGGGCCCGAGTACAAGAAATGGGGGGATGACTTTGATATCGACCAAAAGACG
AAAAACATTAGCAGCGATCTGGCCCAATATCCCGAGTTACGAGATACTATGGAGAAACTTGTGCCTGAAAAGGTG
CCTTACGCAGACTTTTGGAGAAGATATTATTTCTTGCGGCATGGAATCGAAACAGCCGAATCCAGACGCAGAGAC
CTTCTCAACGCTGCATCGGCAGATGATGAGGTAAGCTGGGACGATGACTCGGACGACGACTCTGGCCCCGGAAAA
GAGGCTGGTACGCAAAAGACAGCTTCTGTGGCTTCATCTACTACGCTGCACCCCAAGGGACAGGCGTCGACTAAA
ACGGTCGAGGCTCGAAAATCCAACGACGAAAAGTCTCAGGCGGATAGTGAGGCCAGCTACGATGTTGTTGGCGCT
ACGTCTGGTAAGACAAGTCAAGCACCAAGTAGCCCCAAGGATGTCAAAAAGGATGACGACAGTGACGAAGATTGG
GAGTAG
Transcript >OphauG2|736
ATGGACCTTGCATATGACCACATCCAGGAGGATGCTTATTACAAGGATAACGCCTCGTCTAGCGATACCCCCAAG
CCTGAGCAGCAGTCGTCGCTCAACACCGACTTGCAAGACGCCTACAAGGCCATTAGCTCCAGTCCCTGGGGCCTC
AAAATTGGCGGCTTTCTCGGCAACGTCGTGAAGCAGGGCGAGTCAGTCTATAACCAAGCTCAAAAGGAATTGGCC
GAGGTCGGCGAGGATGCATCCAGAGGCTTCACTGATTTGCGTGAATCGCTCATAACTCGAACTCGAGCTCTATCT
CTCCATACGTCCCCGGAGCAAAAGGCTCCTGGTGAGGCTGGTGAGGGAGAGGATGCATCTTCGACGCCCACCCGG
TCCACCGCTCCTCCAACAGAAGACGCTGCACAGCAACATGAGACTGTCCTCTCTAGGCTACGAAGCGAGGCCACC
AAACGACTCAAAGATCTTCAAAAAGCCGAAGATGCTGCTGACGAGGCGCTATTAAGATTTGGCGGCAACGTGCGC
GATTTCTTGCGCGACGCCATCAGTATTGCCCCGCCCGACGAATCCTCACAGAATAGCGACGTCTTATTTGAGAGC
AAGGATGCGCTTGGGAAACGTGTCATTCACACTTCGAGGTTTGATGCGCAGTTGCATGTGATCCACACGTCGGCA
GACCGTCTATCGGAAGATCCTCCTGGGCCCGAGTACAAGAAATGGGGGGATGACTTTGATATCGACCAAAAGACG
AAAAACATTAGCAGCGATCTGGCCCAATATCCCGAGTTACGAGATACTATGGAGAAACTTGTGCCTGAAAAGGTG
CCTTACGCAGACTTTTGGAGAAGATATTATTTCTTGCGGCATGGAATCGAAACAGCCGAATCCAGACGCAGAGAC
CTTCTCAACGCTGCATCGGCAGATGATGAGGTAAGCTGGGACGATGACTCGGACGACGACTCTGGCCCCGGAAAA
GAGGCTGGTACGCAAAAGACAGCTTCTGTGGCTTCATCTACTACGCTGCACCCCAAGGGACAGGCGTCGACTAAA
ACGGTCGAGGCTCGAAAATCCAACGACGAAAAGTCTCAGGCGGATAGTGAGGCCAGCTACGATGTTGTTGGCGCT
ACGTCTGGTAAGACAAGTCAAGCACCAAGTAGCCCCAAGGATGTCAAAAAGGATGACGACAGTGACGAAGATTGG
GAGTAG
Gene >OphauG2|736
ATGGACCTTGCATATGACCACATCCAGGAGGATGCTTATTACAAGGATAACGCCTCGTCTAGCGATACCCCCAAG
CCTGAGCAGCAGTCGTCGCTCAACACCGACTTGCAAGACGCCTACAAGGCCATTAGCTCCAGTCCCTGGGGCCTC
AAAATTGGCGGCTTTCTCGGCAACGTCGTGAAGCAGGTTGGCCATTCTTTCAAACACCAAATACATGCCAACGAG
CTGTATGCTGATATGAGGGCCCAGGGCGAGTCAGTCTATAACCAAGCTCAAAAGGAATTGGCCGAGGTCGGCGAG
GATGCATCCAGAGGCTTCACTGATTTGCGTGAATCGCTCATAACTCGAACTCGAGCTCTATCTCTCCATACGTCC
CCGGAGCAAAAGGCTCCTGGTGAGGCTGGTGAGGGAGAGGATGCATCTTCGACGCCCACCCGGTCCACCGCTCCT
CCAACAGAAGACGCTGCACAGCAACATGAGACTGTCCTCTCTAGGCTACGAAGCGAGGCCACCAAACGACTCAAA
GATCTTCAAAAAGCCGAAGATGCTGCTGACGAGGCGCTATTAAGATTTGGCGGCAACGTGCGCGATTTCTTGCGC
GACGCCATCAGTATTGCCCCGCCCGACGAATCCTCACAGAATAGCGACGTCTTATTTGAGAGCAAGGATGCGCTT
GGGAAACGTGTCATTCACACTTCGAGGTTTGATGCGCAGTTGCATGTGATCCACACGTCGGCAGACCGTCTATCG
GAAGATCCTCCTGGGCCCGAGTACAAGAAATGGGGGGATGACTTTGATATCGACCAAAAGACGAAAAACATTAGC
AGCGATCTGGCCCAATATCCCGAGTTACGAGATACTATGGAGAAACTTGTGCCTGAAAAGGTGCCTTACGCAGAC
TTTTGGAGAAGATATTATTTCTTGCGGCATGGAATCGAAACAGCCGAATCCAGACGCAGAGACCTTCTCAACGGT
GAGCCAGGATGGACTATGCTTGACGATATTGGCTAGCTAATCTGTTTCTCGCGATAAAGCTGCATCGGCAGATGA
TGAGGTAAGCTGGGACGATGACTCGGACGACGACTCTGGCCCCGGAAAAGAGGCTGGTACGCAAAAGACAGCTTC
TGTGGCTTCATCTACTACGCTGCACCCCAAGGGACAGGCGTCGACTAAAACGGTCGAGGCTCGAAAATCCAACGA
CGAAAAGTCTCAGGCGGATAGTGAGGCCAGCTACGATGTTGTTGGCGCTACGTCTGGTAAGACAAGTCAAGCACC
AAGTAGCCCCAAGGATGTCAAAAAGGATGACGACAGTGACGAAGATTGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail