Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7349
Gene name
LocationContig_845:31..1134
Strand+
Gene length (bp)1103
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 7.8E-26 15 347

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A3LZU8|RMGL_PICST L-rhamnono-gamma-lactonase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LRA2 PE=1 SV=2 14 347 5.0E-42

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7349
MAAPPQEQQLLLPIIDSHIHLWPASEASNLAWHSSSHPLASQQSMTQYRTATAPAPSLLGFIFVEADRIHDLEAD
DWTGPLDEVRWMRRIALGEPRDDEGHDAADAKLCLGLVPWAPLPRGPAVLQNYLDAAQQAAGDAWPKVKGFRYLL
QDKPPGTMLQKDFIDGLKLLGRKGFVFEIGVDHHRRGNKHIEQVVEMVGRAHQDVPEQEKVTFVLDHLGKPDLGI
YNVTSDPAFTAWRTAMYTLSKASRTYVKLSGAFAEMSDSLRTQPPAQMFQSVLAWLGIVLATFGPERLMFGSDWP
LCSLDGLGDEGWDKWRQVVEKMCWMASLDDVGRAMIFGGTAKKAYGL*
Coding >OphauG2|7349
ATGGCCGCCCCGCCCCAAGAGCAGCAGCTCCTGCTCCCCATCATCGACTCCCACATTCATCTCTGGCCCGCCTCT
GAAGCCTCGAATCTGGCATGGCACTCTTCCTCGCACCCGCTCGCATCCCAGCAGTCCATGACGCAGTACCGCACC
GCCACGGCGCCCGCCCCGTCGCTCCTCGGCTTCATCTTTGTCGAGGCTGACCGCATCCATGACCTAGAGGCAGAT
GACTGGACCGGCCCGCTCGACGAAGTGCGCTGGATGCGTCGTATTGCCCTCGGCGAGCCCCGCGACGACGAGGGC
CATGATGCAGCAGACGCCAAGCTCTGTCTGGGCCTCGTGCCCTGGGCGCCCTTGCCCCGAGGCCCGGCCGTCTTG
CAAAACTACCTCGACGCTGCCCAGCAGGCTGCCGGCGATGCCTGGCCCAAGGTAAAGGGCTTCAGGTACCTGCTT
CAGGACAAACCGCCCGGCACCATGCTGCAAAAGGACTTTATCGACGGGCTCAAGCTCCTTGGCCGCAAAGGCTTC
GTCTTTGAAATCGGCGTCGACCATCACCGTCGCGGAAACAAACATATCGAACAAGTGGTGGAGATGGTTGGCCGT
GCTCATCAGGACGTGCCCGAGCAGGAAAAAGTCACCTTTGTGCTAGACCACCTCGGCAAGCCAGATCTTGGCATC
TACAACGTCACGTCGGATCCAGCCTTTACCGCATGGCGCACGGCAATGTACACCTTGTCCAAGGCGTCGCGCACC
TACGTCAAGCTCTCTGGTGCCTTTGCCGAAATGTCCGACTCGTTGCGCACGCAGCCCCCGGCCCAAATGTTCCAG
TCGGTGCTCGCCTGGCTGGGCATCGTACTCGCCACCTTTGGCCCCGAGCGCCTCATGTTTGGCTCCGACTGGCCT
CTGTGCTCCCTCGACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCAGGTGGTGGAAAAGATGTGCTGGATG
GCCAGTCTTGATGACGTTGGACGGGCCATGATTTTTGGCGGCACGGCAAAAAAGGCCTATGGGCTATGA
Transcript >OphauG2|7349
ATGGCCGCCCCGCCCCAAGAGCAGCAGCTCCTGCTCCCCATCATCGACTCCCACATTCATCTCTGGCCCGCCTCT
GAAGCCTCGAATCTGGCATGGCACTCTTCCTCGCACCCGCTCGCATCCCAGCAGTCCATGACGCAGTACCGCACC
GCCACGGCGCCCGCCCCGTCGCTCCTCGGCTTCATCTTTGTCGAGGCTGACCGCATCCATGACCTAGAGGCAGAT
GACTGGACCGGCCCGCTCGACGAAGTGCGCTGGATGCGTCGTATTGCCCTCGGCGAGCCCCGCGACGACGAGGGC
CATGATGCAGCAGACGCCAAGCTCTGTCTGGGCCTCGTGCCCTGGGCGCCCTTGCCCCGAGGCCCGGCCGTCTTG
CAAAACTACCTCGACGCTGCCCAGCAGGCTGCCGGCGATGCCTGGCCCAAGGTAAAGGGCTTCAGGTACCTGCTT
CAGGACAAACCGCCCGGCACCATGCTGCAAAAGGACTTTATCGACGGGCTCAAGCTCCTTGGCCGCAAAGGCTTC
GTCTTTGAAATCGGCGTCGACCATCACCGTCGCGGAAACAAACATATCGAACAAGTGGTGGAGATGGTTGGCCGT
GCTCATCAGGACGTGCCCGAGCAGGAAAAAGTCACCTTTGTGCTAGACCACCTCGGCAAGCCAGATCTTGGCATC
TACAACGTCACGTCGGATCCAGCCTTTACCGCATGGCGCACGGCAATGTACACCTTGTCCAAGGCGTCGCGCACC
TACGTCAAGCTCTCTGGTGCCTTTGCCGAAATGTCCGACTCGTTGCGCACGCAGCCCCCGGCCCAAATGTTCCAG
TCGGTGCTCGCCTGGCTGGGCATCGTACTCGCCACCTTTGGCCCCGAGCGCCTCATGTTTGGCTCCGACTGGCCT
CTGTGCTCCCTCGACGGCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCAGGTGGTGGAAAAGATGTGCTGGATG
GCCAGTCTTGATGACGTTGGACGGGCCATGATTTTTGGCGGCACGGCAAAAAAGGCCTATGGGCTATGA
Gene >OphauG2|7349
ATGGCCGCCCCGCCCCAAGAGCAGCAGCTCCTGCTCCCCATCATCGACTCCCACATTCATCTCTGGCCCGCCTCT
GAAGCCTCGAATCTGGCATGGCACTCTTCCTCGCACCCGCTCGCATCCCAGCAGTCCATGACGCAGTACCGCACC
GCCACGGCGCCCGCCCCGTCGCTCCTCGGCTTCATCTTTGTCGAGGCTGACCGCATCCATGACCTAGAGGCAGAT
GACTGGACCGGCCCGCTCGACGAAGTGCGCTGGATGCGTCGTATTGCCCTCGGCGAGCCCCGCGACGACGAGGGC
CATGATGCAGCAGACGCCAAGCTCTGTCTGGGCCTCGTGCCCTGGGCGCCCTTGCCCCGAGGCCCGGCCGTCTTG
CAAAACTACCTCGACGCTGCCCAGCAGGCTGCCGGCGATGCCTGGCCCAAGGTAAAGGGCTTCAGGTACCTGCTT
CAGGACAAACCGCCCGGCACCATGCTGCAAAAGGACTTTATCGACGGGCTCAAGCTCCTTGGCCGCAAAGGCTTC
GTCTTTGAAATCGGCGTCGACCATCACCGTCGCGGAAACAAACATATCGAACAAGTGGTGGAGATGGTTGGCCGT
GCTCATCAGGACGTGCCCGAGCAGGAAAAAGTCACCTTTGTGCTAGGTCTATGCTCGTCCCCAGCCTGCGTGCTT
GTTGTCATGCTGATTCAACTTGTCCGCCAGACCACCTCGGCAAGCCAGATCTTGGCATCTACAACGTCACGTCGG
ATCCAGCCTTTACCGCATGGCGCACGGCAATGTACACCTTGTCCAAGGCGTCGCGCACCTACGTCAAGCTCTCTG
GTGCCTTTGCCGAAATGTCCGACTCGTTGCGCACGCAGCCCCCGGCCCAAATGTTCCAGTCGGTGCTCGCCTGGC
TGGGCATCGTACTCGCCACCTTTGGCCCCGAGCGCCTCATGTTTGGCTCCGACTGGCCTCTGTGCTCCCTCGACG
GCCTGGGCGACGAGGGCTGGGACAAGTGGCGCCAGGTGGTGGAAAAGATGTGCTGGATGGCCAGTCTTGATGACG
TTGGACGGGCCATGATTTTTGGCGGCACGGCAAAAAAGGCCTATGGGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail