Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7346
Gene name
LocationContig_844:3918..5490
Strand+
Gene length (bp)1572
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 8.2E-19 235 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 15 399 2.0E-57
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 30 398 1.0E-55
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 87 375 3.0E-23
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 87 375 3.0E-21
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 83 377 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 15 399 2.0E-57
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 30 398 1.0E-55
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 87 375 3.0E-23
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 87 375 3.0E-21
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 83 377 2.0E-20
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 83 377 3.0E-19
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 83 377 7.0E-19
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 157 384 2.0E-16
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 71 379 9.0E-14
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 184 380 3.0E-11
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 86 380 3.0E-11
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 87 384 7.0E-11
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 237 380 1.0E-10
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 237 380 1.0E-10
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 236 379 1.0E-10
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 204 379 2.0E-10
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 237 380 3.0E-10
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 237 380 3.0E-10
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 191 380 3.0E-10
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 237 380 4.0E-10
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 237 387 5.0E-10
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 236 385 6.0E-10
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 71 379 6.0E-10
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 65 381 6.0E-10
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 236 385 1.0E-09
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 73 380 1.0E-09
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 237 380 2.0E-09
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 237 379 2.0E-09
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 236 380 3.0E-09
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 237 380 3.0E-09
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 71 379 4.0E-09
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 236 384 5.0E-09
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 236 379 5.0E-09
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 236 385 7.0E-09
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 236 385 8.0E-09
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 236 385 1.0E-08
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 237 380 2.0E-08
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 237 380 2.0E-08
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 237 384 2.0E-08
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 236 380 2.0E-08
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 236 384 3.0E-08
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 236 384 3.0E-08
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 237 384 3.0E-08
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 236 384 3.0E-08
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 237 375 4.0E-08
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 237 380 5.0E-08
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 237 384 6.0E-08
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 218 379 2.0E-07
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 235 398 2.0E-07
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 237 384 3.0E-07
sp|P0DH60|M3OM2_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 2 OS=Pisum sativum GN=HMM2 PE=1 SV=1 236 379 3.0E-07
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 188 382 3.0E-07
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 250 379 4.0E-07
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 236 386 6.0E-07
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 235 396 7.0E-07
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 246 395 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7346
MSLNSTQYEVLAEQIESILRNLENTTAEINDDKIRRRLVIGARKLAVSLEQPRETLRRISHSSFHLPLALVGVES
GVFAALATDSRPFNIAELAEKTGVDKGLLKKLLRYYQATDVLSQIDDDMYQSNNVTRALNNQDRANTLRWARKII
APGALTLPDHLQSNQYKDPTGIFPTAWTSSVPTDKHPYEYLADNPWALKLAQAYMRNQREGRPLFFHVLDFETRF
GQKTNSSTILFVDVGGSTGSQCLALRQRYPNLPGRVMIQDRPEVVKQLKGKIDASANIEAEEHDIFTPQPVKGAR
AYYMRNIFHAWGDATCKDILVNAKAGMNDQSVMLIDEIVLPERGATAQGSEHDIEVMICVGGIERTKAQWESLLN
DTGLKILEVVKYDEDYEDSLIIAALN*
Coding >OphauG2|7346
ATGAGTCTCAACAGCACCCAGTATGAAGTACTGGCAGAGCAGATTGAATCCATTCTGCGAAATCTGGAAAACACC
ACTGCCGAAATCAACGATGACAAAATCCGCCGCCGCCTAGTCATTGGTGCGCGCAAGCTCGCAGTGTCTTTGGAA
CAGCCCAGGGAAACGTTGCGCAGAATCAGTCACTCGTCCTTCCACCTACCTCTTGCTCTCGTGGGCGTGGAAAGT
GGCGTGTTCGCCGCTTTGGCGACCGACTCTCGCCCTTTCAACATCGCAGAGCTCGCAGAGAAGACGGGCGTCGAC
AAAGGCCTCTTGAAGAAACTGCTACGGTATTATCAGGCCACTGATGTGCTATCTCAAATTGACGACGACATGTAC
CAGTCGAATAATGTGACTCGAGCTCTAAACAACCAAGATCGCGCCAACACGCTCCGATGGGCCCGTAAAATCATT
GCGCCAGGAGCATTGACGCTTCCGGACCATCTCCAATCAAACCAGTACAAAGACCCCACTGGCATATTTCCGACG
GCTTGGACCAGCTCCGTTCCCACAGACAAGCATCCCTACGAATATTTAGCTGACAATCCTTGGGCGTTAAAGCTC
GCCCAAGCGTACATGAGGAACCAACGGGAAGGTAGGCCGTTGTTTTTCCATGTCCTGGACTTTGAAACGCGCTTT
GGGCAGAAGACGAACAGCTCGACCATTCTGTTTGTTGACGTCGGTGGCTCAACGGGCTCTCAGTGTCTTGCCCTG
CGCCAGCGATATCCAAACCTCCCTGGGAGAGTCATGATCCAAGATCGACCCGAGGTAGTAAAGCAGTTGAAAGGG
AAGATTGACGCCTCTGCCAACATTGAGGCAGAAGAGCACGATATCTTTACACCTCAGCCCGTCAAAGGAGCCCGA
GCTTATTATATGCGCAACATCTTTCATGCGTGGGGAGATGCCACATGCAAGGACATCTTGGTCAACGCCAAAGCA
GGAATGAATGACCAGTCAGTAATGTTGATTGACGAAATAGTCCTCCCTGAGCGAGGAGCTACAGCTCAGGGATCC
GAACACGATATTGAGGTGATGATATGCGTAGGTGGGATAGAGCGCACAAAGGCCCAGTGGGAAAGTTTGTTGAAT
GACACTGGACTGAAAATACTTGAAGTGGTTAAATATGACGAGGATTACGAAGATTCCTTGATCATTGCCGCTCTC
AATTAA
Transcript >OphauG2|7346
ATGAGTCTCAACAGCACCCAGTATGAAGTACTGGCAGAGCAGATTGAATCCATTCTGCGAAATCTGGAAAACACC
ACTGCCGAAATCAACGATGACAAAATCCGCCGCCGCCTAGTCATTGGTGCGCGCAAGCTCGCAGTGTCTTTGGAA
CAGCCCAGGGAAACGTTGCGCAGAATCAGTCACTCGTCCTTCCACCTACCTCTTGCTCTCGTGGGCGTGGAAAGT
GGCGTGTTCGCCGCTTTGGCGACCGACTCTCGCCCTTTCAACATCGCAGAGCTCGCAGAGAAGACGGGCGTCGAC
AAAGGCCTCTTGAAGAAACTGCTACGGTATTATCAGGCCACTGATGTGCTATCTCAAATTGACGACGACATGTAC
CAGTCGAATAATGTGACTCGAGCTCTAAACAACCAAGATCGCGCCAACACGCTCCGATGGGCCCGTAAAATCATT
GCGCCAGGAGCATTGACGCTTCCGGACCATCTCCAATCAAACCAGTACAAAGACCCCACTGGCATATTTCCGACG
GCTTGGACCAGCTCCGTTCCCACAGACAAGCATCCCTACGAATATTTAGCTGACAATCCTTGGGCGTTAAAGCTC
GCCCAAGCGTACATGAGGAACCAACGGGAAGGTAGGCCGTTGTTTTTCCATGTCCTGGACTTTGAAACGCGCTTT
GGGCAGAAGACGAACAGCTCGACCATTCTGTTTGTTGACGTCGGTGGCTCAACGGGCTCTCAGTGTCTTGCCCTG
CGCCAGCGATATCCAAACCTCCCTGGGAGAGTCATGATCCAAGATCGACCCGAGGTAGTAAAGCAGTTGAAAGGG
AAGATTGACGCCTCTGCCAACATTGAGGCAGAAGAGCACGATATCTTTACACCTCAGCCCGTCAAAGGAGCCCGA
GCTTATTATATGCGCAACATCTTTCATGCGTGGGGAGATGCCACATGCAAGGACATCTTGGTCAACGCCAAAGCA
GGAATGAATGACCAGTCAGTAATGTTGATTGACGAAATAGTCCTCCCTGAGCGAGGAGCTACAGCTCAGGGATCC
GAACACGATATTGAGGTGATGATATGCGTAGGTGGGATAGAGCGCACAAAGGCCCAGTGGGAAAGTTTGTTGAAT
GACACTGGACTGAAAATACTTGAAGTGGTTAAATATGACGAGGATTACGAAGATTCCTTGATCATTGCCGCTCTC
AATTAA
Gene >OphauG2|7346
ATGAGTCTCAACAGCACCCAGTATGAAGTACTGGCAGAGCAGATTGAATCCATTCTGCGAAATCTGGAAAACACC
ACTGCCGAAATCAACGATGACAAAATCCGCCGCCGCCTAGTCATTGGTGCGCGCAAGCTCGCAGTGTCTTTGGAA
CAGCCCAGGGAAACGTTGCGCAGAATCAGTCACTCGGTGTGTACAGTCGACAACCCAGTCTTGAAATTGAAATTG
ACAACAGCCGTCATCAGTCCTTCCACCTACCTCTTGCTCTCGTGGGCGTGGAAAGTGGCGTGTTCGCCGCTTTGG
CGACCGACTCTCGCCCTTTCAACATCGCAGAGCTCGCAGAGAAGACGGGCGTCGACAAAGGCCTCTTGAGTAGGT
TATGCCCATTCCTACACACTAGTTGAGAGACACTAAATATTCTCAGAGAAACTGCTACGGTATTATCAGGCCACT
GATGTGCTATCTCAAATTGACGACGACATGTACCAGTCGAATAATGTGACTCGAGCTCTAAACAACCAAGATCGC
GCCAACACGCTCCGATGGGCGTTAGTATACCCTCAACTTGTGCTATGTTTTTCGCCACGCTAATGTTGGGCGACC
AGCCGTAAAATCATTGCGCCAGGAGCATTGACGCTTCCGGACCATCTCCAATCAAACCAGTACAAAGACCCCACT
GGCATATTTCCGACGGCTTGGACCAGCTCCGTTCCCACAGACAAGCATCCCTACGAATATTTAGCTGACAATCCT
TGGGCGTTAAAGCTCGCCCAAGCGTACATGAGGAACCAACGGGAAGGTAGGCCGTTGTTTTTCCATGTCCTGGAC
TTTGAAACGCGCTTTGGGCAGAAGACGAACAGCTCGACCATTCTGTTTGTTGACGTCGGTGGCTCAACGGGCTCT
CAGTGTCTTGCCCTGCGCCAGCGATATCCAAACCTCCCTGGGAGAGTCATGATCCAAGATCGACCCGAGGTAGTA
AAGCAGTTGAAAGGGAAGATTGACGCCTCTGCCAACATTGAGGCAGAAGAGCACGATATCTTTACACCTCAGCCC
GTCAAAGGTATGGTTTGCCTCTTGAAGATATTAGATCCCCTTGAAAATACTAGATACAGGAGACATGCCCACTGA
CACCTATTTATTTTCCTGTCGCCAAGGAGCCCGAGCTTATTATATGCGCAACATCTTTCATGCGTGGGGAGATGC
CACATGCAAGGACATCTTGGTCAACGCCAAAGCAGGAATGAATGACCAGTCAGTAATGTTGATTGACGAAATAGT
CCTCCCTGAGCGAGGAGCTACAGCTCAGGGATCCGAACACGATATTGAGGTGATGATATGCGTAGGTAAGTTGAC
AGATACCCATTCACTTGAGCCATGTTTTCGACCTGTCTGCCATTTTGGGATCTACCTGTCAGTAAATTAAGTTTT
GCTGACACGACGACTTTTGCAGGTGGGATAGAGCGCACAAAGGCCCAGTGGGAAAGTTTGTTGAATGACACTGGA
CTGAAAATACTTGAAGTGGTTAAATATGACGAGGATTACGAAGATTCCTTGATCATTGCCGCTCTCAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail