Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7340
Gene name
LocationContig_843:860..2345
Strand-
Gene length (bp)1485
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 6.3E-22 19 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 2 394 6.0E-82
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 16 394 1.0E-81
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 16 413 9.0E-81
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 16 400 3.0E-80
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 16 394 4.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 2 394 6.0E-82
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 16 394 1.0E-81
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 16 413 9.0E-81
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 16 400 3.0E-80
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 16 394 4.0E-80
sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.05c PE=2 SV=1 16 398 1.0E-63
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 16 391 2.0E-63
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 16 393 5.0E-49
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 16 391 1.0E-43
sp|F4JJE0|CCT2_ARATH Choline-phosphate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 16 173 4.0E-27
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 16 165 1.0E-25
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 16 165 2.0E-25
sp|Q9ZV56|CCT1_ARATH Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 16 159 2.0E-25
sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 16 165 6.0E-25
sp|P49584|PCY1A_CRIGR Choline-phosphate cytidylyltransferase A OS=Cricetulus griseus GN=PCYT1A PE=2 SV=1 16 165 8.0E-25
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 16 185 1.0E-24
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 16 185 1.0E-24
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 16 185 2.0E-24
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 10 165 2.0E-22
sp|P49587|PCY1_PLAFK Choline-phosphate cytidylyltransferase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CTP PE=2 SV=1 17 159 4.0E-22
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 16 165 3.0E-21
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 9 146 2.0E-20
sp|P49583|PCY1_CAEEL Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans GN=F08C6.2 PE=3 SV=2 16 165 1.0E-16
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 10 183 7.0E-15
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 10 146 2.0E-12
sp|Q0VM60|HLDE_ALCBS Bifunctional protein HldE OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hldE PE=3 SV=1 17 145 2.0E-08
sp|Q3A526|HLDE_PELCD Bifunctional protein HldE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hldE PE=3 SV=1 17 146 8.0E-08
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 209 396 5.0E-07
sp|Q2SN34|HLDE_HAHCH Bifunctional protein HldE OS=Hahella chejuensis (strain KCTC 2396) GN=hldE PE=3 SV=1 17 79 6.0E-07
sp|O58466|RIBL_PYRHO FAD synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ribL PE=3 SV=1 16 140 7.0E-07
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 170 396 1.0E-06
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 170 396 2.0E-06
sp|C6DDL3|HLDE_PECCP Bifunctional protein HldE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hldE PE=3 SV=1 17 145 2.0E-06
sp|Q6D164|HLDE_PECAS Bifunctional protein HldE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hldE PE=3 SV=2 17 149 2.0E-06
sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 223 411 5.0E-06
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 223 411 6.0E-06
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 223 411 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009058 biosynthetic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7340 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7541
Ophiocordyceps camponoti-floridani Ophcf2|06931
Ophiocordyceps camponoti-rufipedis Ophun1|6203
Ophiocordyceps kimflemingae Ophio5|2645
Ophiocordyceps subramaniannii Hirsu2|11162

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7340
MSGLEGDAAPELLDSRIWVDGCFDFFHHGHAGAMVQARQLGTELYVGVHSDEDILANKGPTVMTLQERLAATNAC
RWVTRSISHAPYVTQLPFISHHGCKYVVHGDDITSDSDGNDCYRFVKEAGRFKVVKRSPGISTTDLVGRMLLCTK
THFIHSLQRMLAGQEGSGSPEERAQDAQSMMDRLRLYATDETAHAPGAQVWFWTAHEKPADSGGMCSKLLDGPAP
RPGQRLVYVDGGFDLFSSGHIEFLRKVAMEEEDLARKAANSGLHHAPAYVVVGVHEDGVINEWKGVNYPIMNIFE
RGLCYINAIVFGAPFAPTKPYLQQLPWGVPDVIYHGPTSFMPLTYDPYTDPKKMGIYKEIGHHAFSEVNAGEIVQ
RIMRSRDLYEARQRAKGVKAQVEAAARHREKLEHEQRLKEAAAAGTELAQ*
Coding >OphauG2|7340
ATGAGTGGACTCGAGGGCGACGCAGCTCCTGAGCTGCTGGACAGTCGCATATGGGTCGATGGCTGCTTTGACTTT
TTCCACCATGGCCATGCTGGCGCCATGGTGCAGGCCAGACAGCTGGGCACCGAGCTCTACGTCGGCGTCCACTCT
GATGAGGACATTCTGGCCAACAAGGGCCCAACAGTCATGACGCTGCAAGAGCGACTTGCCGCTACCAACGCCTGC
CGCTGGGTCACAAGATCCATCTCACACGCGCCCTATGTGACACAGCTGCCCTTTATATCGCACCATGGCTGCAAG
TATGTGGTGCACGGAGACGACATCACGTCGGACAGCGACGGCAACGACTGCTACCGCTTCGTCAAGGAGGCTGGC
CGTTTCAAGGTGGTTAAGCGCTCCCCGGGAATATCCACCACCGATTTGGTCGGCCGCATGCTGCTCTGCACAAAG
ACACACTTTATACACTCGCTGCAGCGCATGCTGGCCGGCCAGGAAGGCAGCGGCTCGCCAGAGGAGCGCGCCCAA
GACGCACAGAGCATGATGGATCGCCTGCGCCTCTACGCCACGGATGAGACGGCCCACGCACCCGGCGCTCAAGTC
TGGTTTTGGACAGCCCATGAAAAGCCTGCCGACAGTGGAGGCATGTGTAGCAAGCTCCTCGACGGTCCGGCGCCG
CGACCGGGACAACGCCTCGTCTATGTCGATGGCGGCTTCGACTTGTTTTCCAGCGGCCATATCGAGTTTCTCCGC
AAAGTCGCCATGGAAGAAGAAGACTTGGCCCGCAAGGCAGCCAATAGCGGCCTCCACCATGCACCTGCCTATGTA
GTGGTGGGAGTACATGAAGACGGCGTCATCAATGAGTGGAAAGGCGTCAACTATCCCATCATGAATATCTTTGAG
CGCGGTCTCTGTTACATCAACGCCATTGTCTTTGGAGCCCCCTTTGCGCCAACAAAGCCATACCTACAACAGCTT
CCATGGGGCGTTCCAGACGTGATTTACCACGGGCCCACATCCTTCATGCCATTGACGTATGACCCGTACACCGAC
CCCAAGAAAATGGGCATATATAAAGAAATTGGCCACCATGCCTTTTCCGAGGTAAACGCTGGCGAGATTGTTCAA
CGCATCATGCGCAGCCGCGACTTGTACGAGGCTCGGCAGCGCGCAAAGGGTGTCAAGGCACAGGTTGAGGCAGCC
GCACGACATCGCGAGAAGCTCGAACACGAGCAGCGCCTCAAGGAGGCGGCGGCCGCAGGTACCGAATTGGCCCAA
TAA
Transcript >OphauG2|7340
ATGAGTGGACTCGAGGGCGACGCAGCTCCTGAGCTGCTGGACAGTCGCATATGGGTCGATGGCTGCTTTGACTTT
TTCCACCATGGCCATGCTGGCGCCATGGTGCAGGCCAGACAGCTGGGCACCGAGCTCTACGTCGGCGTCCACTCT
GATGAGGACATTCTGGCCAACAAGGGCCCAACAGTCATGACGCTGCAAGAGCGACTTGCCGCTACCAACGCCTGC
CGCTGGGTCACAAGATCCATCTCACACGCGCCCTATGTGACACAGCTGCCCTTTATATCGCACCATGGCTGCAAG
TATGTGGTGCACGGAGACGACATCACGTCGGACAGCGACGGCAACGACTGCTACCGCTTCGTCAAGGAGGCTGGC
CGTTTCAAGGTGGTTAAGCGCTCCCCGGGAATATCCACCACCGATTTGGTCGGCCGCATGCTGCTCTGCACAAAG
ACACACTTTATACACTCGCTGCAGCGCATGCTGGCCGGCCAGGAAGGCAGCGGCTCGCCAGAGGAGCGCGCCCAA
GACGCACAGAGCATGATGGATCGCCTGCGCCTCTACGCCACGGATGAGACGGCCCACGCACCCGGCGCTCAAGTC
TGGTTTTGGACAGCCCATGAAAAGCCTGCCGACAGTGGAGGCATGTGTAGCAAGCTCCTCGACGGTCCGGCGCCG
CGACCGGGACAACGCCTCGTCTATGTCGATGGCGGCTTCGACTTGTTTTCCAGCGGCCATATCGAGTTTCTCCGC
AAAGTCGCCATGGAAGAAGAAGACTTGGCCCGCAAGGCAGCCAATAGCGGCCTCCACCATGCACCTGCCTATGTA
GTGGTGGGAGTACATGAAGACGGCGTCATCAATGAGTGGAAAGGCGTCAACTATCCCATCATGAATATCTTTGAG
CGCGGTCTCTGTTACATCAACGCCATTGTCTTTGGAGCCCCCTTTGCGCCAACAAAGCCATACCTACAACAGCTT
CCATGGGGCGTTCCAGACGTGATTTACCACGGGCCCACATCCTTCATGCCATTGACGTATGACCCGTACACCGAC
CCCAAGAAAATGGGCATATATAAAGAAATTGGCCACCATGCCTTTTCCGAGGTAAACGCTGGCGAGATTGTTCAA
CGCATCATGCGCAGCCGCGACTTGTACGAGGCTCGGCAGCGCGCAAAGGGTGTCAAGGCACAGGTTGAGGCAGCC
GCACGACATCGCGAGAAGCTCGAACACGAGCAGCGCCTCAAGGAGGCGGCGGCCGCAGGTACCGAATTGGCCCAA
TAA
Gene >OphauG2|7340
ATGAGTGGACTCGAGGGCGACGCAGCTCCTGAGCTGCTGGACAGTCGCATATGGGTCGATGGCTGCTTTGACTTT
TTCCACCATGGTATGCCCTGTCGCGTCTACCATGGCATGATGCGTGCTGACCAGCCAGCCACAAAGGCCATGCTG
GCGCCATGGTGCAGGCCAGACAGCTGGGCACCGAGCTCTACGTCGGCGTCCACTCTGATGAGGACATTCTGGCCA
ACAAGGGCCCAACAGTCATGACGCTGCAAGAGCGGTAGCCCGGCCTTGCTTCCCGCCTGGATGCTTCAAGTCTCT
TGCGCTGACTTGCCCTTCCCCTGCAGACTTGCCGCTACCAACGCCTGCCGCTGGGTCACAAGATCCATCTCACAC
GCGCCCTATGTGACACAGCTGCCCTTTATATCGCACCATGGCTGCAAGTATGTGGTGCACGGAGACGACATCACG
TCGGACAGCGACGGCAACGACTGCTACCGCTTCGTCAAGGAGGCTGGCCGTTTCAAGGTGGTTAAGCGCTCCCCG
GGAATATCCACCACCGATTTGGTCGGCCGCATGCTGCTCTGCACAAAGACACACTTTATACACTCGCTGCAGCGC
ATGCTGGCCGGCCAGGAAGGCAGCGGCTCGCCAGAGGAGCGCGCCCAAGACGCACAGAGCATGATGGATCGCCTG
CGCCTCTACGCCACGGATGAGACGGCCCACGCACCCGGCGCTCAAGTCTGGTTTTGGACAGCCCATGAAAAGCCT
GCCGACAGTGGAGGCATGTGTAGCAAGCTCCTCGACGGTCCGGCGCCGCGACCGGGACAACGCCTCGTCTATGTC
GATGGCGGCTTCGACTTGTTTTCCAGCGGCCATATCGAGTTTCTCCGCAAAGTCGCCATGGAAGAAGAAGACTTG
GCCCGCAAGGCAGCCAATAGCGGCCTCCACCATGCACCTGCCTATGTAGTGGTGGGAGTACATGAAGACGGCGTC
ATCAATGAGTGGAAAGGCGTCAACTATCCCATCATGAATATCTTTGAGCGCGGTCTCTGTGTGCTGCAGTGCAAG
GCAAGTTTTCCACGCGCCATACCCAGATGACACAAGACACGCCTCTGACCTGCCTTACCCTCCTTGCAGTACATC
AACGCCATTGTCTTTGGAGCCCCCTTTGCGCCAACAAAGCCATACCTACAACAGCTTCCATGGGGCGTTCCAGAC
GTGATTTACCACGGGCCCACATCCTTCATGCCATTGACGTATGACCCGTACACCGACCCCAAGAAAATGGGCATA
TATAAAGAAATTGGCCACCATGCCTTTTCCGAGGTAAACGCTGGCGAGATTGTTCAACGCATCATGCGCAGCCGC
GACTTGTACGAGGCTCGGCAGCGCGCAAAGGGTGTCAAGGCACAGGTTGAGGCAGCCGCACGACATCGCGAGAAG
CTCGAACACGAGCAGCGCCTCAAGGAGGCGGCGGCCGCAGGTACCGAATTGGCCCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail