Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7327
Gene name
LocationContig_84:26605..28214
Strand-
Gene length (bp)1609
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14420 Clr5 Clr5 domain 3.2E-20 31 84

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5346
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7327 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4913
Ophiocordyceps kimflemingae Ophio5|878
Ophiocordyceps subramaniannii Hirsu2|5154
Ophiocordyceps subramaniannii Hirsu2|6265

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7327
MADAPLRALAPRQSSLDASASPDRHGPKEHSEAEWETHRSLIDRLYIAEGRKLVEVMSILRSRHGFDATEQMYKK
RLRKWNIRKRSYRKSASGIVTPTSTPSLDADDDADETLPHKPCLALDHHRLSSPGPFGSLELVLDSVCVWSLGKL
DSFALDLDPMSRYLASPNKPPMADSRTMYRTFELVFDLWSHGKGQLAGMAARRAFYALEFVLTEDHPDIIWHILD
AIYDMADRGHTQLLGIFLTYANMLARTRLPTNHPLLRILHQLVQTDYQTDQGRQQLCHTLAQAWRRNSNILAEHI
GSLAPRHLWLYEQLIWDGRTPLRKGTSNLAERKEAMLNALGALLQRHHPPTNNDPLDHDHLRIAALMLEYTQMDL
GDKQQAHVLAQQLLDRTASDAGGRSNARFHAYACKMMARLQHDRHDFVHAEKNLRCAVVKREAAHGADSDLRVIR
DMWVLAAHLKRANRHDDAAQTIRDALARAERFLRQPDASCVELR*
Coding >OphauG2|7327
ATGGCCGACGCGCCGCTGAGAGCCCTGGCGCCCCGACAGTCGAGTCTGGACGCGTCTGCCAGTCCGGACCGCCAT
GGCCCCAAGGAGCACAGCGAGGCCGAGTGGGAGACGCATCGCAGCCTCATAGACCGGCTGTACATTGCCGAGGGC
CGCAAGCTGGTCGAGGTCATGTCCATTCTGCGCTCGCGCCACGGATTCGACGCCACCGAGCAAATGTACAAGAAG
CGTCTGAGGAAATGGAACATTCGAAAACGCAGCTACCGCAAGTCGGCCAGCGGCATCGTCACGCCCACTTCAACG
CCCTCGCTCGACGCCGACGACGACGCCGACGAGACGCTGCCGCACAAGCCCTGTCTGGCCCTCGACCACCACCGC
CTCAGCAGCCCCGGGCCCTTTGGCAGCCTCGAGCTCGTCCTCGACAGCGTCTGTGTGTGGAGCCTGGGCAAGCTC
GACTCCTTCGCCCTCGACCTGGACCCCATGTCGCGCTACCTGGCCAGCCCCAACAAACCCCCCATGGCCGACAGT
CGCACCATGTACCGCACCTTTGAGCTCGTCTTTGATCTGTGGTCGCACGGCAAGGGCCAGCTGGCCGGCATGGCA
GCCCGCCGTGCCTTTTACGCCCTCGAGTTTGTCTTGACCGAGGACCACCCCGACATCATCTGGCACATCCTCGAT
GCCATCTACGACATGGCTGACCGCGGCCACACGCAGCTGCTGGGCATCTTTCTGACCTATGCCAACATGCTGGCC
CGGACGCGTCTGCCCACCAACCACCCCTTGCTGAGAATCCTCCACCAGCTGGTCCAGACCGACTACCAGACCGAC
CAGGGGCGCCAGCAGCTGTGCCACACCCTTGCCCAAGCCTGGCGGCGCAACTCCAACATCCTCGCCGAGCACATT
GGCTCCCTGGCCCCTCGCCATCTTTGGCTCTACGAGCAGCTCATCTGGGATGGTCGCACGCCCTTGCGCAAAGGC
ACCAGCAACCTCGCCGAGCGAAAAGAGGCCATGCTCAACGCTCTCGGCGCTCTCCTTCAACGCCACCACCCCCCA
ACCAACAACGACCCCCTGGACCACGACCACTTGCGCATCGCCGCCCTCATGCTCGAGTACACGCAAATGGACCTG
GGCGACAAGCAGCAGGCCCACGTGCTGGCACAGCAACTGCTCGACCGCACCGCCTCCGACGCCGGCGGCCGATCC
AATGCCCGCTTCCATGCCTATGCGTGCAAGATGATGGCCAGGCTGCAGCACGACAGACACGACTTTGTCCACGCA
GAGAAGAATCTGCGCTGTGCTGTCGTGAAGCGCGAGGCTGCCCATGGCGCCGACTCGGACCTGCGTGTCATTCGC
GACATGTGGGTGCTGGCGGCCCATTTGAAACGGGCAAATAGGCACGACGATGCGGCCCAGACTATACGCGATGCT
CTTGCCAGGGCAGAGAGGTTTCTGCGGCAGCCTGATGCAAGCTGTGTCGAGCTGCGGTGA
Transcript >OphauG2|7327
ATGGCCGACGCGCCGCTGAGAGCCCTGGCGCCCCGACAGTCGAGTCTGGACGCGTCTGCCAGTCCGGACCGCCAT
GGCCCCAAGGAGCACAGCGAGGCCGAGTGGGAGACGCATCGCAGCCTCATAGACCGGCTGTACATTGCCGAGGGC
CGCAAGCTGGTCGAGGTCATGTCCATTCTGCGCTCGCGCCACGGATTCGACGCCACCGAGCAAATGTACAAGAAG
CGTCTGAGGAAATGGAACATTCGAAAACGCAGCTACCGCAAGTCGGCCAGCGGCATCGTCACGCCCACTTCAACG
CCCTCGCTCGACGCCGACGACGACGCCGACGAGACGCTGCCGCACAAGCCCTGTCTGGCCCTCGACCACCACCGC
CTCAGCAGCCCCGGGCCCTTTGGCAGCCTCGAGCTCGTCCTCGACAGCGTCTGTGTGTGGAGCCTGGGCAAGCTC
GACTCCTTCGCCCTCGACCTGGACCCCATGTCGCGCTACCTGGCCAGCCCCAACAAACCCCCCATGGCCGACAGT
CGCACCATGTACCGCACCTTTGAGCTCGTCTTTGATCTGTGGTCGCACGGCAAGGGCCAGCTGGCCGGCATGGCA
GCCCGCCGTGCCTTTTACGCCCTCGAGTTTGTCTTGACCGAGGACCACCCCGACATCATCTGGCACATCCTCGAT
GCCATCTACGACATGGCTGACCGCGGCCACACGCAGCTGCTGGGCATCTTTCTGACCTATGCCAACATGCTGGCC
CGGACGCGTCTGCCCACCAACCACCCCTTGCTGAGAATCCTCCACCAGCTGGTCCAGACCGACTACCAGACCGAC
CAGGGGCGCCAGCAGCTGTGCCACACCCTTGCCCAAGCCTGGCGGCGCAACTCCAACATCCTCGCCGAGCACATT
GGCTCCCTGGCCCCTCGCCATCTTTGGCTCTACGAGCAGCTCATCTGGGATGGTCGCACGCCCTTGCGCAAAGGC
ACCAGCAACCTCGCCGAGCGAAAAGAGGCCATGCTCAACGCTCTCGGCGCTCTCCTTCAACGCCACCACCCCCCA
ACCAACAACGACCCCCTGGACCACGACCACTTGCGCATCGCCGCCCTCATGCTCGAGTACACGCAAATGGACCTG
GGCGACAAGCAGCAGGCCCACGTGCTGGCACAGCAACTGCTCGACCGCACCGCCTCCGACGCCGGCGGCCGATCC
AATGCCCGCTTCCATGCCTATGCGTGCAAGATGATGGCCAGGCTGCAGCACGACAGACACGACTTTGTCCACGCA
GAGAAGAATCTGCGCTGTGCTGTCGTGAAGCGCGAGGCTGCCCATGGCGCCGACTCGGACCTGCGTGTCATTCGC
GACATGTGGGTGCTGGCGGCCCATTTGAAACGGGCAAATAGGCACGACGATGCGGCCCAGACTATACGCGATGCT
CTTGCCAGGGCAGAGAGGTTTCTGCGGCAGCCTGATGCAAGCTGTGTCGAGCTGCGGTGA
Gene >OphauG2|7327
ATGGCCGACGCGCCGCTGAGAGCCCTGGCGCCCCGACAGTCGAGTCTGGACGCGTCTGCCAGTCCGGACCGCCAT
GGCCCCAAGGAGCACAGCGAGGCCGAGTGGGAGACGCATCGCAGCCTCATAGACCGGCTGTACATTGCCGAGGGC
CGCAAGCTGGTCGAGGTCATGTCCATTCTGCGCTCGCGCCACGGATTCGACGCCACGTGAGTCTCTCTTGTGCGA
CATGCAGCGGCCGGGGGGGAAAAAAAGAGAGACTCTGGATAGCCGGCCCGCCTCTCCTTGTCTTTCTCTCTCCCT
GCTAACCCCCCCCTGTTTGGGACCCTGCAGCGAGCAAATGTACAAGAAGCGTCTGAGGAAATGGAACATTCGAAA
ACGCAGCTACCGCAAGTCGGCCAGCGGCATCGTCACGCCCACTTCAACGCCCTCGCTCGACGCCGACGACGACGC
CGACGAGACGCTGCCGCACAAGCCCTGTCTGGCCCTCGACCACCACCGCCTCAGCAGCCCCGGGCCCTTTGGCAG
CCTCGAGCTCGTCCTCGACAGCGTCTGTGTGTGGAGCCTGGGCAAGCTCGACTCCTTCGCCCTCGACCTGGACCC
CATGTCGCGCTACCTGGCCAGCCCCAACAAACCCCCCATGGCCGACAGTCGCACCATGTACCGCACCTTTGAGCT
CGTCTTTGATCTGTGGTCGCACGGCAAGGGCCAGCTGGCCGGCATGGCAGCCCGCCGTGCCTTTTACGCCCTCGA
GTTTGTCTTGACCGAGGACCACCCCGACATCATCTGGCACATCCTCGATGCCATCTACGACATGGCTGACCGCGG
CCACACGCAGCTGCTGGGCATCTTTCTGACCTATGCCAACATGCTGGCCCGGACGCGTCTGCCCACCAACCACCC
CTTGCTGAGAATCCTCCACCAGCTGGTCCAGACCGACTACCAGACCGACCAGGGGCGCCAGCAGCTGTGCCACAC
CCTTGCCCAAGCCTGGCGGCGCAACTCCAACATCCTCGCCGAGCACATTGGCTCCCTGGCCCCTCGCCATCTTTG
GCTCTACGAGCAGCTCATCTGGGATGGTCGCACGCCCTTGCGCAAAGGCACCAGCAACCTCGCCGAGCGAAAAGA
GGCCATGCTCAACGCTCTCGGCGCTCTCCTTCAACGCCACCACCCCCCAACCAACAACGACCCCCTGGACCACGA
CCACTTGCGCATCGCCGCCCTCATGCTCGAGTACACGCAAATGGACCTGGGCGACAAGCAGCAGGCCCACGTGCT
GGCACAGCAACTGCTCGACCGCACCGCCTCCGACGCCGGCGGCCGATCCAATGCCCGCTTCCATGCCTATGCGTG
CAAGATGATGGCCAGGCTGCAGCACGACAGACACGACTTTGTCCACGCAGAGAAGAATCTGCGCTGTGCTGTCGT
GAAGCGCGAGGCTGCCCATGGCGCCGACTCGGACCTGCGTGTCATTCGCGACATGTGGGTGCTGGCGGCCCATTT
GAAACGGGCAAATAGGCACGACGATGCGGCCCAGACTATACGCGATGCTCTTGCCAGGGCAGAGAGGTTTCTGCG
GCAGCCTGATGCAAGCTGTGTCGAGCTGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail