Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7324
Gene name
LocationContig_84:22523..23164
Strand-
Gene length (bp)641
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus 3.4E-22 65 146
PF00281 Ribosomal_L5 Ribosomal protein L5 1.4E-20 8 61

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVN0|RL11_NEUCR 60S ribosomal protein L11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-11 PE=3 SV=2 4 173 8.0E-113
sp|P0C0W9|RL11A_YEAST 60S ribosomal protein L11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11A PE=1 SV=2 3 172 9.0E-100
sp|Q3E757|RL11B_YEAST 60S ribosomal protein L11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11B PE=1 SV=3 3 172 1.0E-99
sp|Q758S7|RL11_ASHGO 60S ribosomal protein L11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL11 PE=3 SV=1 3 172 2.0E-99
sp|P0CT78|RL11B_SCHPO 60S ribosomal protein L11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1102 PE=2 SV=1 3 172 7.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVN0|RL11_NEUCR 60S ribosomal protein L11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-11 PE=3 SV=2 4 173 8.0E-113
sp|P0C0W9|RL11A_YEAST 60S ribosomal protein L11-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11A PE=1 SV=2 3 172 9.0E-100
sp|Q3E757|RL11B_YEAST 60S ribosomal protein L11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL11B PE=1 SV=3 3 172 1.0E-99
sp|Q758S7|RL11_ASHGO 60S ribosomal protein L11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL11 PE=3 SV=1 3 172 2.0E-99
sp|P0CT78|RL11B_SCHPO 60S ribosomal protein L11-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1102 PE=2 SV=1 3 172 7.0E-98
sp|P0CT77|RL11A_SCHPO 60S ribosomal protein L11-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1101 PE=2 SV=1 3 172 7.0E-98
sp|Q6FTK4|RL11_CANGA 60S ribosomal protein L11 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL11 PE=3 SV=1 3 172 4.0E-97
sp|Q94300|RL11_CAEEL 60S ribosomal protein L11 OS=Caenorhabditis elegans GN=rpl-11.1 PE=3 SV=1 4 172 3.0E-94
sp|P42795|RL111_ARATH 60S ribosomal protein L11-1 OS=Arabidopsis thaliana GN=RPL11A PE=2 SV=2 1 172 8.0E-92
sp|P46287|RL11_MEDSA 60S ribosomal protein L11 OS=Medicago sativa GN=RPL11 PE=2 SV=1 1 172 1.0E-91
sp|P42794|RL112_ARATH 60S ribosomal protein L11-2 OS=Arabidopsis thaliana GN=RPL11B PE=2 SV=2 1 172 5.0E-91
sp|Q0DK10|RL11_ORYSJ 60S ribosomal protein L11 OS=Oryza sativa subsp. japonica GN=RPL11 PE=2 SV=1 1 172 4.0E-90
sp|A2YDY2|RL11_ORYSI 60S ribosomal protein L11 OS=Oryza sativa subsp. indica GN=RPL11 PE=2 SV=2 1 172 4.0E-90
sp|Q90YV7|RL11_ICTPU 60S ribosomal protein L11 OS=Ictalurus punctatus GN=rpl11 PE=2 SV=3 3 172 4.0E-90
sp|Q5RC11|RL11_PONAB 60S ribosomal protein L11 OS=Pongo abelii GN=RPL11 PE=2 SV=3 1 172 4.0E-90
sp|P62914|RL11_RAT 60S ribosomal protein L11 OS=Rattus norvegicus GN=Rpl11 PE=1 SV=2 1 172 2.0E-89
sp|Q9CXW4|RL11_MOUSE 60S ribosomal protein L11 OS=Mus musculus GN=Rpl11 PE=1 SV=4 1 172 2.0E-89
sp|P62913|RL11_HUMAN 60S ribosomal protein L11 OS=Homo sapiens GN=RPL11 PE=1 SV=2 1 172 2.0E-89
sp|Q6QMZ8|RL11_CHILA 60S ribosomal protein L11 OS=Chinchilla lanigera GN=RPL11 PE=2 SV=3 1 172 2.0E-89
sp|Q3T087|RL11_BOVIN 60S ribosomal protein L11 OS=Bos taurus GN=RPL11 PE=2 SV=3 1 172 2.0E-89
sp|Q29205|RL11_PIG 60S ribosomal protein L11 OS=Sus scrofa GN=RPL11 PE=1 SV=3 1 172 8.0E-89
sp|P46222|RL11_DROME 60S ribosomal protein L11 OS=Drosophila melanogaster GN=RpL11 PE=1 SV=2 4 172 1.0E-88
sp|P16168|RL11_DICDI 60S ribosomal protein L11 OS=Dictyostelium discoideum GN=rpl11 PE=1 SV=2 5 172 4.0E-85
sp|P42922|RL11_LEICH 60S ribosomal protein L11 OS=Leishmania chagasi GN=RPL11 PE=2 SV=1 1 172 1.0E-83
sp|P48157|RL11_LEIMA 60S ribosomal protein L11 OS=Leishmania major GN=RPL11 PE=3 SV=1 1 172 2.0E-83
sp|P24119|RL11_TETTH 60S ribosomal protein L11 OS=Tetrahymena thermophila GN=RPL11 PE=1 SV=1 3 172 9.0E-75
sp|Q962U2|RL11_SPOFR 60S ribosomal protein L11 OS=Spodoptera frugiperda GN=RpL11 PE=2 SV=1 6 172 1.0E-74
sp|P50881|RL11_CHLRE 60S ribosomal protein L11 OS=Chlamydomonas reinhardtii GN=RPL11 PE=2 SV=1 10 172 5.0E-74
sp|Q8SSG9|RL11_ENCCU 60S ribosomal protein L11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL11 PE=1 SV=2 3 172 1.0E-70
sp|Q94793|RL11_TOXCA 60S ribosomal protein L11 (Fragment) OS=Toxocara canis GN=RPL11 PE=2 SV=1 5 116 3.0E-63
sp|Q9UX93|RL5_SULSO 50S ribosomal protein L5 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl5 PE=3 SV=1 6 169 8.0E-50
sp|Q5JJG1|RL5_THEKO 50S ribosomal protein L5 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl5 PE=3 SV=1 8 161 1.0E-47
sp|P54040|RL5_METJA 50S ribosomal protein L5 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl5 PE=3 SV=1 8 168 9.0E-46
sp|O59431|RL5_PYRHO 50S ribosomal protein L5 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl5 PE=3 SV=1 8 168 4.0E-44
sp|Q9YF87|RL5_AERPE 50S ribosomal protein L5 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl5 PE=3 SV=2 1 168 2.0E-43
sp|Q8U012|RL5_PYRFU 50S ribosomal protein L5 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl5 PE=1 SV=1 8 168 5.0E-43
sp|A6UQ57|RL5_METVS 50S ribosomal protein L5 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl5 PE=3 SV=1 9 168 7.0E-43
sp|P14029|RL5_METVA 50S ribosomal protein L5 OS=Methanococcus vannielii GN=rpl5 PE=3 SV=1 9 168 7.0E-43
sp|Q9V1U9|RL5_PYRAB 50S ribosomal protein L5 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl5 PE=3 SV=1 8 168 7.0E-43
sp|Q975J3|RL5_SULTO 50S ribosomal protein L5 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl5 PE=3 SV=2 1 169 2.0E-42
sp|Q12ZT8|RL5_METBU 50S ribosomal protein L5 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl5 PE=3 SV=1 7 168 3.0E-42
sp|Q6LXE0|RL5_METMP 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl5 PE=3 SV=1 9 169 4.0E-42
sp|P41202|RL5_SULAC 50S ribosomal protein L5 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl5 PE=3 SV=1 1 169 8.0E-42
sp|A9A9Q1|RL5_METM6 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl5 PE=3 SV=1 9 169 2.0E-41
sp|A6VGZ8|RL5_METM7 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl5 PE=3 SV=1 9 169 5.0E-41
sp|A5UL75|RL5_METS3 50S ribosomal protein L5 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl5 PE=3 SV=1 8 169 5.0E-41
sp|A4FWA8|RL5_METM5 50S ribosomal protein L5 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl5 PE=3 SV=1 9 169 7.0E-41
sp|A8MB19|RL5_CALMQ 50S ribosomal protein L5 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl5 PE=3 SV=1 8 166 1.0E-40
sp|Q97BW3|RL5_THEVO 50S ribosomal protein L5 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl5 PE=3 SV=1 8 168 1.0E-40
sp|Q74N79|RL5_NANEQ 50S ribosomal protein L5 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl5 PE=3 SV=1 7 168 2.0E-40
sp|O26124|RL5_METTH 50S ribosomal protein L5 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl5 PE=3 SV=1 8 168 2.0E-40
sp|A9A5I2|RL5_NITMS 50S ribosomal protein L5 OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl5 PE=3 SV=1 3 168 4.0E-40
sp|O28367|RL5_ARCFU 50S ribosomal protein L5 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl5 PE=3 SV=1 8 166 2.0E-38
sp|Q6L1B4|RL5_PICTO 50S ribosomal protein L5 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl5 PE=3 SV=1 4 169 2.0E-38
sp|A0RVY6|RL5_CENSY 50S ribosomal protein L5 OS=Cenarchaeum symbiosum (strain A) GN=rpl5 PE=3 SV=1 10 168 3.0E-38
sp|Q8PV37|RL5_METMA 50S ribosomal protein L5 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl5 PE=3 SV=1 7 168 6.0E-38
sp|Q2NFX0|RL5_METST 50S ribosomal protein L5 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl5 PE=3 SV=1 8 169 6.0E-38
sp|Q56231|RL5_THEAC 50S ribosomal protein L5 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl5 PE=3 SV=1 8 168 2.0E-37
sp|A7I5Q2|RL5_METB6 50S ribosomal protein L5 OS=Methanoregula boonei (strain 6A8) GN=rpl5 PE=3 SV=1 10 173 3.0E-37
sp|Q8TRT4|RL5_METAC 50S ribosomal protein L5 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl5 PE=3 SV=1 10 168 4.0E-37
sp|Q8TW17|RL5_METKA 50S ribosomal protein L5 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl5 PE=3 SV=1 7 169 5.0E-37
sp|B9LSR4|RL5_HALLT 50S ribosomal protein L5 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl5 PE=3 SV=1 3 169 1.0E-36
sp|P50559|RL5_HALVD 50S ribosomal protein L5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rpl5 PE=1 SV=2 3 169 1.0E-36
sp|Q46GA8|RL5_METBF 50S ribosomal protein L5 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl5 PE=3 SV=1 7 168 4.0E-36
sp|Q3IMX5|RL5_NATPD 50S ribosomal protein L5 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl5 PE=3 SV=1 10 169 4.0E-36
sp|Q18GG2|RL5_HALWD 50S ribosomal protein L5 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl5 PE=3 SV=1 10 168 6.0E-36
sp|Q2FT38|RL5_METHJ 50S ribosomal protein L5 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl5 PE=3 SV=1 8 169 6.0E-36
sp|P50557|RL5_HALMT 50S ribosomal protein L5 OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=rpl5 PE=1 SV=2 3 169 9.0E-36
sp|A6UWV1|RL5_META3 50S ribosomal protein L5 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl5 PE=3 SV=1 9 163 9.0E-36
sp|P50558|RL5_HALSA 50S ribosomal protein L5 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl5 PE=1 SV=3 10 169 1.0E-35
sp|B0R669|RL5_HALS3 50S ribosomal protein L5 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl5 PE=3 SV=1 10 169 1.0E-35
sp|Q8ZSU7|RL5_PYRAE 50S ribosomal protein L5 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl5 PE=3 SV=1 8 166 1.0E-35
sp|A2SPL5|RL5_METLZ 50S ribosomal protein L5 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl5 PE=3 SV=1 10 168 8.0E-35
sp|P14124|RL5_HALMA 50S ribosomal protein L5 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl5 PE=1 SV=4 10 169 2.0E-34
sp|A3CT10|RL5_METMJ 50S ribosomal protein L5 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl5 PE=3 SV=1 10 168 2.0E-32
sp|A7IPQ8|RL5_XANP2 50S ribosomal protein L5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplE PE=3 SV=1 8 133 5.0E-18
sp|A8IAQ3|RL5_AZOC5 50S ribosomal protein L5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplE PE=3 SV=1 8 133 1.0E-17
sp|Q8UE30|RL5_AGRFC 50S ribosomal protein L5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplE PE=3 SV=1 8 133 3.0E-16
sp|Q2YRA7|RL5_BRUA2 50S ribosomal protein L5 OS=Brucella abortus (strain 2308) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|Q8G085|RL5_BRUSU 50S ribosomal protein L5 OS=Brucella suis biovar 1 (strain 1330) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|B0CH20|RL5_BRUSI 50S ribosomal protein L5 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|A5VQZ4|RL5_BRUO2 50S ribosomal protein L5 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|Q8YHM8|RL5_BRUME 50S ribosomal protein L5 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|C0RJI9|RL5_BRUMB 50S ribosomal protein L5 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|A9M5N8|RL5_BRUC2 50S ribosomal protein L5 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|Q57CS0|RL5_BRUAB 50S ribosomal protein L5 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|B2S667|RL5_BRUA1 50S ribosomal protein L5 OS=Brucella abortus (strain S19) GN=rplE PE=3 SV=1 5 133 2.0E-15
sp|A7HWS3|RL5_PARL1 50S ribosomal protein L5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplE PE=3 SV=1 8 133 2.0E-15
sp|A6X0D0|RL5_OCHA4 50S ribosomal protein L5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplE PE=3 SV=1 5 133 5.0E-15
sp|B9JVP9|RL5_AGRVS 50S ribosomal protein L5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplE PE=3 SV=1 8 141 7.0E-15
sp|Q98N45|RL5_RHILO 50S ribosomal protein L5 OS=Rhizobium loti (strain MAFF303099) GN=rplE PE=3 SV=1 7 133 1.0E-14
sp|Q134U1|RL5_RHOPS 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|Q11HR4|RL5_CHESB 50S ribosomal protein L5 OS=Chelativorans sp. (strain BNC1) GN=rplE PE=3 SV=1 5 133 2.0E-14
sp|Q9A8U1|RL5_CAUCR 50S ribosomal protein L5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplE PE=3 SV=1 7 133 2.0E-14
sp|B8H4E6|RL5_CAUCN 50S ribosomal protein L5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplE PE=3 SV=1 7 133 2.0E-14
sp|B3PWT3|RL5_RHIE6 50S ribosomal protein L5 OS=Rhizobium etli (strain CIAT 652) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|B9JDU0|RL5_AGRRK 50S ribosomal protein L5 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|Q2K9K4|RL5_RHIEC 50S ribosomal protein L5 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplE PE=3 SV=1 8 133 2.0E-14
sp|B0T2D4|RL5_CAUSK 50S ribosomal protein L5 OS=Caulobacter sp. (strain K31) GN=rplE PE=3 SV=1 7 133 2.0E-14
sp|Q6FZD4|RL5_BARQU 50S ribosomal protein L5 OS=Bartonella quintana (strain Toulouse) GN=rplE PE=3 SV=1 4 133 3.0E-14
sp|A9IW11|RL5_BART1 50S ribosomal protein L5 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplE PE=3 SV=1 4 133 3.0E-14
sp|C4K7A6|RL5_HAMD5 50S ribosomal protein L5 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplE PE=3 SV=1 10 133 4.0E-14
sp|Q07KN0|RL5_RHOP5 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplE PE=3 SV=1 8 133 4.0E-14
sp|B5ZYU7|RL5_RHILW 50S ribosomal protein L5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplE PE=3 SV=1 8 133 5.0E-14
sp|Q211G0|RL5_RHOPB 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplE PE=3 SV=1 8 133 6.0E-14
sp|B3QBW8|RL5_RHOPT 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|Q6N4U5|RL5_RHOPA 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplE PE=1 SV=1 8 133 1.0E-13
sp|Q6G2X7|RL5_BARHE 50S ribosomal protein L5 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplE PE=3 SV=1 4 133 1.0E-13
sp|B6JEX7|RL5_OLICO 50S ribosomal protein L5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplE PE=3 SV=1 7 133 1.0E-13
sp|B4R8M9|RL5_PHEZH 50S ribosomal protein L5 OS=Phenylobacterium zucineum (strain HLK1) GN=rplE PE=3 SV=1 7 133 1.0E-13
sp|Q5GWU7|RL5_XANOR 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|B2SQS2|RL5_XANOP 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|Q2NZZ7|RL5_XANOM 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplE PE=3 SV=1 8 133 1.0E-13
sp|A6U871|RL5_SINMW 50S ribosomal protein L5 OS=Sinorhizobium medicae (strain WSM419) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|Q8PC39|RL5_XANCP 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|B0RU70|RL5_XANCB 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|Q4URF1|RL5_XANC8 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplE PE=3 SV=1 8 133 2.0E-13
sp|Q6MSN8|RL5_MYCMS 50S ribosomal protein L5 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplE PE=3 SV=1 10 133 3.0E-13
sp|Q3BWX1|RL5_XANC5 50S ribosomal protein L5 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q1MIC9|RL5_RHIL3 50S ribosomal protein L5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q8PNR4|RL5_XANAC 50S ribosomal protein L5 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q2W2K3|RL5_MAGSA 50S ribosomal protein L5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q2IXP8|RL5_RHOP2 50S ribosomal protein L5 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|A5ELL5|RL5_BRASB 50S ribosomal protein L5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|A4YSK4|RL5_BRASO 50S ribosomal protein L5 OS=Bradyrhizobium sp. (strain ORS278) GN=rplE PE=3 SV=1 8 133 3.0E-13
sp|Q9ZCR7|RL5_RICPR 50S ribosomal protein L5 OS=Rickettsia prowazekii (strain Madrid E) GN=rplE PE=3 SV=1 14 127 4.0E-13
sp|O67568|RL5_AQUAE 50S ribosomal protein L5 OS=Aquifex aeolicus (strain VF5) GN=rplE PE=3 SV=1 8 133 4.0E-13
sp|Q92QF8|RL5_RHIME 50S ribosomal protein L5 OS=Rhizobium meliloti (strain 1021) GN=rplE PE=3 SV=1 8 133 4.0E-13
sp|Q89J96|RL5_BRADU 50S ribosomal protein L5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplE PE=3 SV=1 8 133 5.0E-13
sp|C3MAZ2|RL5_RHISN 50S ribosomal protein L5 OS=Rhizobium sp. (strain NGR234) GN=rplE PE=3 SV=1 8 133 6.0E-13
sp|A8GT57|RL5_RICRS 50S ribosomal protein L5 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplE PE=3 SV=1 14 127 6.0E-13
sp|B0BUP8|RL5_RICRO 50S ribosomal protein L5 OS=Rickettsia rickettsii (strain Iowa) GN=rplE PE=3 SV=1 14 127 6.0E-13
sp|P10136|RL5_MYCCT 50S ribosomal protein L5 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplE PE=3 SV=2 10 133 6.0E-13
sp|Q92GX8|RL5_RICCN 50S ribosomal protein L5 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplE PE=3 SV=1 14 127 7.0E-13
sp|C3PP95|RL5_RICAE 50S ribosomal protein L5 OS=Rickettsia africae (strain ESF-5) GN=rplE PE=3 SV=1 14 127 7.0E-13
sp|C4K2G7|RL5_RICPU 50S ribosomal protein L5 OS=Rickettsia peacockii (strain Rustic) GN=rplE PE=3 SV=1 14 127 7.0E-13
sp|Q5WZK0|RL5_LEGPL 50S ribosomal protein L5 OS=Legionella pneumophila (strain Lens) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|A5IHQ2|RL5_LEGPC 50S ribosomal protein L5 OS=Legionella pneumophila (strain Corby) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|Q5X847|RL5_LEGPA 50S ribosomal protein L5 OS=Legionella pneumophila (strain Paris) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|Q5ZYN1|RL5_LEGPH 50S ribosomal protein L5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplE PE=3 SV=1 14 133 8.0E-13
sp|B2FQJ6|RL5_STRMK 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplE PE=3 SV=1 8 133 9.0E-13
sp|B4SKX5|RL5_STRM5 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplE PE=3 SV=1 7 133 9.0E-13
sp|A7HBN0|RL5_ANADF 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplE PE=3 SV=1 8 133 9.0E-13
sp|A7NR51|RL5_ROSCS 50S ribosomal protein L5 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rplE PE=3 SV=1 10 137 9.0E-13
sp|A8EZK4|RL5_RICCK 50S ribosomal protein L5 OS=Rickettsia canadensis (strain McKiel) GN=rplE PE=3 SV=1 14 127 1.0E-12
sp|Q68W90|RL5_RICTY 50S ribosomal protein L5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplE PE=3 SV=1 14 127 1.0E-12
sp|Q6CZY2|RL5_PECAS 50S ribosomal protein L5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplE PE=3 SV=1 7 133 2.0E-12
sp|A4WFB6|RL5_ENT38 50S ribosomal protein L5 OS=Enterobacter sp. (strain 638) GN=rplE PE=3 SV=1 7 133 2.0E-12
sp|A0PXV8|RL5_CLONN 50S ribosomal protein L5 OS=Clostridium novyi (strain NT) GN=rplE PE=3 SV=1 8 133 2.0E-12
sp|Q9ZI40|RL5_AQUPY 50S ribosomal protein L5 OS=Aquifex pyrophilus GN=rplE PE=3 SV=2 8 133 2.0E-12
sp|Q3SSV4|RL5_NITWN 50S ribosomal protein L5 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplE PE=3 SV=1 8 133 2.0E-12
sp|Q1QN18|RL5_NITHX 50S ribosomal protein L5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplE PE=3 SV=1 8 133 3.0E-12
sp|Q9PE64|RL5_XYLFA 50S ribosomal protein L5 OS=Xylella fastidiosa (strain 9a5c) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|B0U5L1|RL5_XYLFM 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M12) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|A8GPD8|RL5_RICAH 50S ribosomal protein L5 OS=Rickettsia akari (strain Hartford) GN=rplE PE=3 SV=1 14 127 3.0E-12
sp|C4L7U2|RL5_TOLAT 50S ribosomal protein L5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|Q87E70|RL5_XYLFT 50S ribosomal protein L5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|B2I8I1|RL5_XYLF2 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M23) GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|A1AVL2|RL5_RUTMC 50S ribosomal protein L5 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplE PE=3 SV=1 7 133 3.0E-12
sp|Q6F1Y2|RL5_MESFL 50S ribosomal protein L5 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplE PE=3 SV=1 10 133 3.0E-12
sp|Q88QM3|RL5_PSEPK 50S ribosomal protein L5 OS=Pseudomonas putida (strain KT2440) GN=rplE PE=3 SV=1 5 133 3.0E-12
sp|B0KK79|RL5_PSEPG 50S ribosomal protein L5 OS=Pseudomonas putida (strain GB-1) GN=rplE PE=3 SV=1 5 133 3.0E-12
sp|A5VXQ9|RL5_PSEP1 50S ribosomal protein L5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplE PE=3 SV=1 5 133 3.0E-12
sp|Q6A6N8|RL5_PROAC 50S ribosomal protein L5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|Q820Q9|RL5_NITEU 50S ribosomal protein L5 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplE PE=3 SV=1 10 133 4.0E-12
sp|Q1AU41|RL5_RUBXD 50S ribosomal protein L5 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplE PE=3 SV=1 7 133 4.0E-12
sp|Q4UMR7|RL5_RICFE 50S ribosomal protein L5 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplE PE=3 SV=1 14 127 4.0E-12
sp|B0K5Q5|RL5_THEPX 50S ribosomal protein L5 OS=Thermoanaerobacter sp. (strain X514) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|B0KCL2|RL5_THEP3 50S ribosomal protein L5 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|Q0ANR2|RL5_MARMM 50S ribosomal protein L5 OS=Maricaulis maris (strain MCS10) GN=rplE PE=3 SV=1 8 133 4.0E-12
sp|B5XNA5|RL5_KLEP3 50S ribosomal protein L5 OS=Klebsiella pneumoniae (strain 342) GN=rplE PE=3 SV=1 7 133 6.0E-12
sp|A9MN60|RL5_SALAR 50S ribosomal protein L5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplE PE=3 SV=1 7 133 6.0E-12
sp|C5BGL3|RL5_EDWI9 50S ribosomal protein L5 OS=Edwardsiella ictaluri (strain 93-146) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|P62405|RL5_SALTY 50S ribosomal protein L5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplE PE=3 SV=2 1 133 6.0E-12
sp|P62404|RL5_SALTI 50S ribosomal protein L5 OS=Salmonella typhi GN=rplE PE=3 SV=2 1 133 6.0E-12
sp|B4TXD0|RL5_SALSV 50S ribosomal protein L5 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5BGX4|RL5_SALPK 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|C0Q0A4|RL5_SALPC 50S ribosomal protein L5 OS=Salmonella paratyphi C (strain RKS4594) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|A9MSY6|RL5_SALPB 50S ribosomal protein L5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|Q5PIU5|RL5_SALPA 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B4SUS8|RL5_SALNS 50S ribosomal protein L5 OS=Salmonella newport (strain SL254) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B4TKK3|RL5_SALHS 50S ribosomal protein L5 OS=Salmonella heidelberg (strain SL476) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5RH27|RL5_SALG2 50S ribosomal protein L5 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5R279|RL5_SALEP 50S ribosomal protein L5 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5FJK2|RL5_SALDC 50S ribosomal protein L5 OS=Salmonella dublin (strain CT_02021853) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|Q57J44|RL5_SALCH 50S ribosomal protein L5 OS=Salmonella choleraesuis (strain SC-B67) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|B5F7T3|RL5_SALA4 50S ribosomal protein L5 OS=Salmonella agona (strain SL483) GN=rplE PE=3 SV=1 1 133 6.0E-12
sp|Q493J6|RL5_BLOPB 50S ribosomal protein L5 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplE PE=3 SV=1 10 127 7.0E-12
sp|Q1IFV4|RL5_PSEE4 50S ribosomal protein L5 OS=Pseudomonas entomophila (strain L48) GN=rplE PE=3 SV=1 5 133 8.0E-12
sp|Q5NQ53|RL5_ZYMMO 50S ribosomal protein L5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplE PE=3 SV=1 14 133 8.0E-12
sp|Q7VQD6|RL5_BLOFL 50S ribosomal protein L5 OS=Blochmannia floridanus GN=rplE PE=3 SV=1 5 127 8.0E-12
sp|Q2S924|RL5_HAHCH 50S ribosomal protein L5 OS=Hahella chejuensis (strain KCTC 2396) GN=rplE PE=3 SV=1 10 127 9.0E-12
sp|B1JAK0|RL5_PSEPW 50S ribosomal protein L5 OS=Pseudomonas putida (strain W619) GN=rplE PE=3 SV=1 5 133 1.0E-11
sp|A8MLF2|RL5_ALKOO 50S ribosomal protein L5 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplE PE=3 SV=1 14 133 1.0E-11
sp|C5CQ88|RL5_VARPS 50S ribosomal protein L5 OS=Variovorax paradoxus (strain S110) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|B9DM35|RL5_STACT 50S ribosomal protein L5 OS=Staphylococcus carnosus (strain TM300) GN=rplE PE=3 SV=1 3 133 1.0E-11
sp|Q1RHN3|RL5_RICBR 50S ribosomal protein L5 OS=Rickettsia bellii (strain RML369-C) GN=rplE PE=3 SV=1 15 127 1.0E-11
sp|A8GVC6|RL5_RICB8 50S ribosomal protein L5 OS=Rickettsia bellii (strain OSU 85-389) GN=rplE PE=3 SV=1 15 127 1.0E-11
sp|Q9HWE7|RL5_PSEAE 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|Q02T68|RL5_PSEAB 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|B7V656|RL5_PSEA8 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|Q8CRH2|RL5_STAES 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplE PE=3 SV=1 14 133 1.0E-11
sp|Q5HM11|RL5_STAEQ 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplE PE=3 SV=1 14 133 1.0E-11
sp|A1USQ6|RL5_BARBK 50S ribosomal protein L5 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplE PE=3 SV=1 8 133 1.0E-11
sp|A0LIK2|RL5_SYNFM 50S ribosomal protein L5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplE PE=3 SV=1 5 133 1.0E-11
sp|Q21M46|RL5_SACD2 50S ribosomal protein L5 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplE PE=3 SV=2 8 133 1.0E-11
sp|Q4L8A2|RL5_STAHJ 50S ribosomal protein L5 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q2NQN4|RL5_SODGM 50S ribosomal protein L5 OS=Sodalis glossinidius (strain morsitans) GN=rplE PE=3 SV=1 10 133 2.0E-11
sp|B4UBB1|RL5_ANASK 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain K) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|Q2IJ79|RL5_ANADE 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|B8J872|RL5_ANAD2 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|B1W3Z5|RL5_STRGG 50S ribosomal protein L5 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|Q5LW46|RL5_RUEPO 50S ribosomal protein L5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|O52344|RL5_MYCGA 50S ribosomal protein L5 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplE PE=3 SV=1 10 142 2.0E-11
sp|A6UZK0|RL5_PSEA7 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain PA7) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|Q5WLQ0|RL5_BACSK 50S ribosomal protein L5 OS=Bacillus clausii (strain KSM-K16) GN=rplE PE=3 SV=1 3 133 2.0E-11
sp|A1WVB0|RL5_HALHL 50S ribosomal protein L5 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplE PE=3 SV=1 7 133 2.0E-11
sp|Q7A083|RL5_STAAW 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MW2) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A8Z345|RL5_STAAT 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q6G783|RL5_STAAS 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MSSA476) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q6GEJ5|RL5_STAAR 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MRSA252) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q7A465|RL5_STAAN 50S ribosomal protein L5 OS=Staphylococcus aureus (strain N315) GN=rplE PE=1 SV=1 14 133 2.0E-11
sp|Q99S33|RL5_STAAM 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A6QJ80|RL5_STAAE 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Newman) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q5HDX0|RL5_STAAC 50S ribosomal protein L5 OS=Staphylococcus aureus (strain COL) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q2YYK9|RL5_STAAB 50S ribosomal protein L5 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A5IV22|RL5_STAA9 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH9) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|Q2FW18|RL5_STAA8 50S ribosomal protein L5 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplE PE=1 SV=1 14 133 2.0E-11
sp|Q2FEQ1|RL5_STAA3 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A6U3W3|RL5_STAA2 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH1) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|A7X5E5|RL5_STAA1 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplE PE=3 SV=1 14 133 2.0E-11
sp|C1DKM5|RL5_AZOVD 50S ribosomal protein L5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplE PE=3 SV=1 8 133 2.0E-11
sp|B2A4F1|RL5_NATTJ 50S ribosomal protein L5 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplE PE=3 SV=1 8 150 2.0E-11
sp|A8LM69|RL5_DINSH 50S ribosomal protein L5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplE PE=3 SV=1 8 137 2.0E-11
sp|Q0AII4|RL5_NITEC 50S ribosomal protein L5 OS=Nitrosomonas eutropha (strain C91) GN=rplE PE=3 SV=1 10 118 2.0E-11
sp|B3CN38|RL5_WOLPP 50S ribosomal protein L5 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rplE PE=3 SV=1 7 127 3.0E-11
sp|Q2G8W8|RL5_NOVAD 50S ribosomal protein L5 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplE PE=3 SV=1 8 133 3.0E-11
sp|C5BQ73|RL5_TERTT 50S ribosomal protein L5 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplE PE=3 SV=1 8 133 3.0E-11
sp|A1KB15|RL5_AZOSB 50S ribosomal protein L5 OS=Azoarcus sp. (strain BH72) GN=rplE PE=3 SV=1 10 133 4.0E-11
sp|Q82DN3|RL5_STRAW 50S ribosomal protein L5 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|Q47J91|RL5_DECAR 50S ribosomal protein L5 OS=Dechloromonas aromatica (strain RCB) GN=rplE PE=3 SV=1 10 133 4.0E-11
sp|A9KJI2|RL5_CLOPH 50S ribosomal protein L5 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|Q65QW7|RL5_MANSM 50S ribosomal protein L5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplE PE=3 SV=1 10 133 4.0E-11
sp|A1TYK9|RL5_MARHV 50S ribosomal protein L5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|A1T0D0|RL5_PSYIN 50S ribosomal protein L5 OS=Psychromonas ingrahamii (strain 37) GN=rplE PE=3 SV=1 10 127 4.0E-11
sp|A1B039|RL5_PARDP 50S ribosomal protein L5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|A6W380|RL5_MARMS 50S ribosomal protein L5 OS=Marinomonas sp. (strain MWYL1) GN=rplE PE=3 SV=1 8 133 4.0E-11
sp|Q1WSA2|RL5_LACS1 50S ribosomal protein L5 OS=Lactobacillus salivarius (strain UCC118) GN=rplE PE=3 SV=1 10 133 5.0E-11
sp|Q1GPB1|RL5_SPHAL 50S ribosomal protein L5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplE PE=3 SV=1 8 133 5.0E-11
sp|Q5P320|RL5_AROAE 50S ribosomal protein L5 OS=Aromatoleum aromaticum (strain EbN1) GN=rplE PE=3 SV=1 10 141 5.0E-11
sp|A7GK32|RL5_BACCN 50S ribosomal protein L5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplE PE=3 SV=1 10 133 5.0E-11
sp|A5CXL6|RL5_VESOH 50S ribosomal protein L5 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplE PE=3 SV=1 7 133 5.0E-11
sp|B7VLE5|RL5_VIBTL 50S ribosomal protein L5 OS=Vibrio tasmaniensis (strain LGP32) GN=rplE PE=3 SV=1 10 127 6.0E-11
sp|A4SSZ4|RL5_AERS4 50S ribosomal protein L5 OS=Aeromonas salmonicida (strain A449) GN=rplE PE=3 SV=1 10 127 6.0E-11
sp|A0KF33|RL5_AERHH 50S ribosomal protein L5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplE PE=3 SV=1 10 127 7.0E-11
sp|P38517|RL5_THEMA 50S ribosomal protein L5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplE PE=3 SV=2 14 142 7.0E-11
sp|Q31IX0|RL5_THICR 50S ribosomal protein L5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplE PE=3 SV=1 10 133 7.0E-11
sp|Q5FTZ5|RL5_GLUOX 50S ribosomal protein L5 OS=Gluconobacter oxydans (strain 621H) GN=rplE PE=3 SV=1 8 127 7.0E-11
sp|A5USH7|RL5_ROSS1 50S ribosomal protein L5 OS=Roseiflexus sp. (strain RS-1) GN=rplE PE=3 SV=1 10 137 7.0E-11
sp|C4ZBT1|RL5_EUBR3 50S ribosomal protein L5 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplE PE=3 SV=1 8 133 8.0E-11
sp|B1LBM8|RL5_THESQ 50S ribosomal protein L5 OS=Thermotoga sp. (strain RQ2) GN=rplE PE=3 SV=1 14 142 8.0E-11
sp|Q0SQF6|RL5_CLOPS 50S ribosomal protein L5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplE PE=3 SV=1 8 127 8.0E-11
sp|Q8XHT5|RL5_CLOPE 50S ribosomal protein L5 OS=Clostridium perfringens (strain 13 / Type A) GN=rplE PE=3 SV=1 8 127 8.0E-11
sp|Q0TMQ8|RL5_CLOP1 50S ribosomal protein L5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplE PE=3 SV=1 8 127 8.0E-11
sp|A4IZS2|RL5_FRATW 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|Q0BNR5|RL5_FRATO 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|A0Q4J5|RL5_FRATN 50S ribosomal protein L5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|Q2A5F8|RL5_FRATH 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|A7N9T7|RL5_FRATF 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|B2SDX3|RL5_FRATM 50S ribosomal protein L5 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplE PE=3 SV=1 7 133 8.0E-11
sp|Q3J8S6|RL5_NITOC 50S ribosomal protein L5 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplE PE=3 SV=1 14 133 8.0E-11
sp|Q5NHV6|RL5_FRATT 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplE PE=3 SV=1 7 133 9.0E-11
sp|Q14JA8|RL5_FRAT1 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplE PE=3 SV=1 7 133 9.0E-11
sp|Q9Z9K2|RL5_BACHD 50S ribosomal protein L5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplE PE=3 SV=1 14 133 9.0E-11
sp|B9DSW2|RL5_STRU0 50S ribosomal protein L5 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplE PE=3 SV=1 3 133 9.0E-11
sp|Q8R7W6|RL5_CALS4 50S ribosomal protein L5 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplE PE=3 SV=1 8 133 9.0E-11
sp|C0Q9W1|RL5_DESAH 50S ribosomal protein L5 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplE PE=3 SV=1 8 133 9.0E-11
sp|B1MW02|RL5_LEUCK 50S ribosomal protein L5 OS=Leuconostoc citreum (strain KM20) GN=rplE PE=3 SV=1 4 133 9.0E-11
sp|Q890P8|RL5_CLOTE 50S ribosomal protein L5 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplE PE=3 SV=1 8 133 9.0E-11
sp|C0R2Z7|RL5_WOLWR 50S ribosomal protein L5 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rplE PE=3 SV=1 8 127 9.0E-11
sp|Q73H98|RL5_WOLPM 50S ribosomal protein L5 OS=Wolbachia pipientis wMel GN=rplE PE=3 SV=1 8 127 9.0E-11
sp|A4VHP2|RL5_PSEU5 50S ribosomal protein L5 OS=Pseudomonas stutzeri (strain A1501) GN=rplE PE=3 SV=1 8 133 1.0E-10
sp|B0UX26|RL5_HISS2 50S ribosomal protein L5 OS=Histophilus somni (strain 2336) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q0I150|RL5_HAES1 50S ribosomal protein L5 OS=Haemophilus somnus (strain 129Pt) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B1YGW2|RL5_EXIS2 50S ribosomal protein L5 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B5YDV5|RL5_DICT6 50S ribosomal protein L5 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplE PE=3 SV=1 8 133 1.0E-10
sp|P44346|RL5_HAEIN 50S ribosomal protein L5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplE PE=3 SV=2 10 133 1.0E-10
sp|A5UHU3|RL5_HAEIG 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittGG) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A5UDT5|RL5_HAEIE 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittEE) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q4QMA9|RL5_HAEI8 50S ribosomal protein L5 OS=Haemophilus influenzae (strain 86-028NP) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B0BSU3|RL5_ACTPJ 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B3GZ23|RL5_ACTP7 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A3N369|RL5_ACTP2 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7GNC8|RL5_BIFLS 50S ribosomal protein L5 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplE PE=3 SV=1 5 110 1.0E-10
sp|Q8G406|RL5_BIFLO 50S ribosomal protein L5 OS=Bifidobacterium longum (strain NCC 2705) GN=rplE PE=3 SV=1 5 110 1.0E-10
sp|B3DQC6|RL5_BIFLD 50S ribosomal protein L5 OS=Bifidobacterium longum (strain DJO10A) GN=rplE PE=3 SV=1 5 110 1.0E-10
sp|B8F6Q9|RL5_HAEPS 50S ribosomal protein L5 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q81VR8|RL5_BACAN 50S ribosomal protein L5 OS=Bacillus anthracis GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C3LJ94|RL5_BACAC 50S ribosomal protein L5 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C3P9R7|RL5_BACAA 50S ribosomal protein L5 OS=Bacillus anthracis (strain A0248) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A9KWB4|RL5_SHEB9 50S ribosomal protein L5 OS=Shewanella baltica (strain OS195) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A6WHU0|RL5_SHEB8 50S ribosomal protein L5 OS=Shewanella baltica (strain OS185) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A3DA60|RL5_SHEB5 50S ribosomal protein L5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B8EBJ3|RL5_SHEB2 50S ribosomal protein L5 OS=Shewanella baltica (strain OS223) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q9CL42|RL5_PASMU 50S ribosomal protein L5 OS=Pasteurella multocida (strain Pm70) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q6HPP6|RL5_BACHK 50S ribosomal protein L5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q63H78|RL5_BACCZ 50S ribosomal protein L5 OS=Bacillus cereus (strain ZK / E33L) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q81J30|RL5_BACCR 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7HJ60|RL5_BACC4 50S ribosomal protein L5 OS=Bacillus cereus (strain B4264) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C1ET51|RL5_BACC3 50S ribosomal protein L5 OS=Bacillus cereus (strain 03BB102) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7JKD1|RL5_BACC0 50S ribosomal protein L5 OS=Bacillus cereus (strain AH820) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A0R8J2|RL5_BACAH 50S ribosomal protein L5 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A6VLK0|RL5_ACTSZ 50S ribosomal protein L5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B9IZK6|RL5_BACCQ 50S ribosomal protein L5 OS=Bacillus cereus (strain Q1) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|B7HQV6|RL5_BACC7 50S ribosomal protein L5 OS=Bacillus cereus (strain AH187) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q73F84|RL5_BACC1 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q28UU2|RL5_JANSC 50S ribosomal protein L5 OS=Jannaschia sp. (strain CCS1) GN=rplE PE=3 SV=1 8 133 1.0E-10
sp|A3Q994|RL5_SHELP 50S ribosomal protein L5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|C3LRP6|RL5_VIBCM 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q9KNZ6|RL5_VIBCH 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A5F554|RL5_VIBC3 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|Q7VKE5|RL5_HAEDU 50S ribosomal protein L5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplE PE=3 SV=1 10 133 1.0E-10
sp|A8F4S3|RL5_PSELT 50S ribosomal protein L5 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplE PE=3 SV=1 14 133 1.0E-10
sp|Q3YRM1|RL5_EHRCJ 50S ribosomal protein L5 OS=Ehrlichia canis (strain Jake) GN=rplE PE=3 SV=1 7 127 1.0E-10
sp|Q2GL47|RL5_ANAPZ 50S ribosomal protein L5 OS=Anaplasma phagocytophilum (strain HZ) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q97EJ0|RL5_CLOAB 50S ribosomal protein L5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplE PE=3 SV=1 8 127 2.0E-10
sp|Q5L411|RL5_GEOKA 50S ribosomal protein L5 OS=Geobacillus kaustophilus (strain HTA426) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|C4KZN4|RL5_EXISA 50S ribosomal protein L5 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|Q03PW9|RL5_LACBA 50S ribosomal protein L5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|A7N0I9|RL5_VIBCB 50S ribosomal protein L5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|A9VP89|RL5_BACWK 50S ribosomal protein L5 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|Q8ETX1|RL5_OCEIH 50S ribosomal protein L5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplE PE=3 SV=1 7 150 2.0E-10
sp|B5FG21|RL5_VIBFM 50S ribosomal protein L5 OS=Vibrio fischeri (strain MJ11) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|A1S230|RL5_SHEAM 50S ribosomal protein L5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|B1KMX1|RL5_SHEWM 50S ribosomal protein L5 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|B7IT31|RL5_BACC2 50S ribosomal protein L5 OS=Bacillus cereus (strain G9842) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|A5N4Q9|RL5_CLOK5 50S ribosomal protein L5 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|B9DYC1|RL5_CLOK1 50S ribosomal protein L5 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q5GSV6|RL5_WOLTR 50S ribosomal protein L5 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplE PE=3 SV=1 8 127 2.0E-10
sp|A1W320|RL5_ACISJ 50S ribosomal protein L5 OS=Acidovorax sp. (strain JS42) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|B9MBU9|RL5_ACIET 50S ribosomal protein L5 OS=Acidovorax ebreus (strain TPSY) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|Q9L0C8|RL5_STRCO 50S ribosomal protein L5 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q5E8A2|RL5_VIBF1 50S ribosomal protein L5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplE PE=3 SV=1 10 128 2.0E-10
sp|Q2RFQ9|RL5_MOOTA 50S ribosomal protein L5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q489A1|RL5_COLP3 50S ribosomal protein L5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplE PE=3 SV=1 10 133 2.0E-10
sp|B8E1E5|RL5_DICTD 50S ribosomal protein L5 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|Q0VSJ1|RL5_ALCBS 50S ribosomal protein L5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|A1WKA4|RL5_VEREI 50S ribosomal protein L5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplE PE=3 SV=1 7 133 2.0E-10
sp|A8GYY8|RL5_SHEPA 50S ribosomal protein L5 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|B0TM00|RL5_SHEHH 50S ribosomal protein L5 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplE PE=3 SV=1 10 127 2.0E-10
sp|B1KSL3|RL5_CLOBM 50S ribosomal protein L5 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplE PE=3 SV=1 8 133 2.0E-10
sp|B6EPT7|RL5_ALISL 50S ribosomal protein L5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplE PE=3 SV=1 10 127 3.0E-10
sp|Q6AP59|RL5_DESPS 50S ribosomal protein L5 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplE PE=3 SV=1 8 118 3.0E-10
sp|Q2GH44|RL5_EHRCR 50S ribosomal protein L5 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplE PE=3 SV=1 7 127 3.0E-10
sp|P33098|RL5_MICLU 50S ribosomal protein L5 OS=Micrococcus luteus GN=rplE PE=3 SV=1 8 133 3.0E-10
sp|A5EX87|RL5_DICNV 50S ribosomal protein L5 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplE PE=3 SV=1 8 127 3.0E-10
sp|Q089P2|RL5_SHEFN 50S ribosomal protein L5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplE PE=3 SV=1 10 133 3.0E-10
sp|Q250M0|RL5_DESHY 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain Y51) GN=rplE PE=3 SV=1 8 133 3.0E-10
sp|B8CNE5|RL5_SHEPW 50S ribosomal protein L5 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplE PE=3 SV=1 10 127 3.0E-10
sp|B8G1X8|RL5_DESHD 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplE PE=3 SV=1 8 133 3.0E-10
sp|B7GJ79|RL5_ANOFW 50S ribosomal protein L5 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplE PE=3 SV=1 10 133 3.0E-10
sp|A8G1D6|RL5_SHESH 50S ribosomal protein L5 OS=Shewanella sediminis (strain HAW-EB3) GN=rplE PE=3 SV=1 10 127 3.0E-10
sp|A4IJK0|RL5_GEOTN 50S ribosomal protein L5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplE PE=3 SV=1 10 133 3.0E-10
sp|P08895|RL5_GEOSE 50S ribosomal protein L5 OS=Geobacillus stearothermophilus GN=rplE PE=1 SV=1 10 133 3.0E-10
sp|Q49ZF6|RL5_STAS1 50S ribosomal protein L5 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplE PE=3 SV=1 14 133 3.0E-10
sp|Q839F2|RL5_ENTFA 50S ribosomal protein L5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplE PE=3 SV=1 10 150 3.0E-10
sp|Q8EK57|RL5_SHEON 50S ribosomal protein L5 OS=Shewanella oneidensis (strain MR-1) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|A4XZ78|RL5_PSEMY 50S ribosomal protein L5 OS=Pseudomonas mendocina (strain ymp) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|A0KRN6|RL5_SHESA 50S ribosomal protein L5 OS=Shewanella sp. (strain ANA-3) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|Q0I093|RL5_SHESR 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-7) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|Q0HNS5|RL5_SHESM 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-4) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|B2GJ05|RL5_KOCRD 50S ribosomal protein L5 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rplE PE=3 SV=1 8 110 4.0E-10
sp|Q03IG3|RL5_STRTD 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplE PE=3 SV=1 14 133 4.0E-10
sp|C3K2W4|RL5_PSEFS 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain SBW25) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q5QXX0|RL5_IDILO 50S ribosomal protein L5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplE PE=3 SV=1 7 127 4.0E-10
sp|C5CC50|RL5_MICLC 50S ribosomal protein L5 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplE PE=3 SV=1 8 133 4.0E-10
sp|Q87T01|RL5_VIBPA 50S ribosomal protein L5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplE PE=3 SV=1 10 127 4.0E-10
sp|Q1R0G3|RL5_CHRSD 50S ribosomal protein L5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplE PE=3 SV=1 8 133 4.0E-10
sp|P12877|RL5_BACSU 50S ribosomal protein L5 OS=Bacillus subtilis (strain 168) GN=rplE PE=1 SV=1 10 133 4.0E-10
sp|Q02W36|RL5_LACLS 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplE PE=3 SV=1 14 150 4.0E-10
sp|A2RNP3|RL5_LACLM 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplE PE=3 SV=1 14 150 4.0E-10
sp|Q9CDX4|RL5_LACLA 50S ribosomal protein L5 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplE PE=3 SV=1 14 150 4.0E-10
sp|Q4ZMQ6|RL5_PSEU2 50S ribosomal protein L5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q48D48|RL5_PSE14 50S ribosomal protein L5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|A7Z0Q0|RL5_BACMF 50S ribosomal protein L5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplE PE=3 SV=1 10 133 4.0E-10
sp|Q3K600|RL5_PSEPF 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q4K545|RL5_PSEF5 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplE PE=3 SV=1 5 133 4.0E-10
sp|Q65P95|RL5_BACLD 50S ribosomal protein L5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|Q5M2C5|RL5_STRT2 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q5LXS3|RL5_STRT1 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q8E2C2|RL5_STRA5 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q8E7S9|RL5_STRA3 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q3K3V7|RL5_STRA1 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q12G91|RL5_POLSJ 50S ribosomal protein L5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplE PE=3 SV=1 7 133 5.0E-10
sp|B2TII7|RL5_CLOBB 50S ribosomal protein L5 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplE PE=3 SV=1 8 133 5.0E-10
sp|B2UYC2|RL5_CLOBA 50S ribosomal protein L5 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplE PE=3 SV=1 8 133 5.0E-10
sp|A1A081|RL5_BIFAA 50S ribosomal protein L5 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplE PE=3 SV=1 7 110 5.0E-10
sp|B8I7Z1|RL5_CLOCE 50S ribosomal protein L5 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|A1REC6|RL5_SHESW 50S ribosomal protein L5 OS=Shewanella sp. (strain W3-18-1) GN=rplE PE=3 SV=1 10 127 5.0E-10
sp|A4YBX1|RL5_SHEPC 50S ribosomal protein L5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplE PE=3 SV=1 10 127 5.0E-10
sp|Q21QN5|RL5_RHOFT 50S ribosomal protein L5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplE PE=3 SV=1 1 133 5.0E-10
sp|A8F997|RL5_BACP2 50S ribosomal protein L5 OS=Bacillus pumilus (strain SAFR-032) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|B1HMW8|RL5_LYSSC 50S ribosomal protein L5 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplE PE=3 SV=1 10 133 5.0E-10
sp|C0QW08|RL5_BRAHW 50S ribosomal protein L5 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplE PE=3 SV=1 14 141 5.0E-10
sp|C0MCC2|RL5_STRS7 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|P0DE57|RL5_STRPQ 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q48VT7|RL5_STRPM 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|A2RC26|RL5_STRPG 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1J901|RL5_STRPF 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1JJ50|RL5_STRPD 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1JP05|RL5_STRPC 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q1JE46|RL5_STRPB 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q7CNP5|RL5_STRP8 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q5XEC3|RL5_STRP6 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|P0DE56|RL5_STRP3 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|Q9A1W2|RL5_STRP1 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M1 GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|B4U512|RL5_STREM 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|C0M9H3|RL5_STRE4 50S ribosomal protein L5 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplE PE=3 SV=1 14 133 5.0E-10
sp|A1VJ27|RL5_POLNA 50S ribosomal protein L5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplE PE=3 SV=1 7 133 6.0E-10
sp|Q2YAY5|RL5_NITMU 50S ribosomal protein L5 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplE PE=3 SV=1 14 133 6.0E-10
sp|A1TJS9|RL5_ACIAC 50S ribosomal protein L5 OS=Acidovorax citrulli (strain AAC00-1) GN=rplE PE=3 SV=1 7 133 6.0E-10
sp|B5XJ48|RL5_STRPZ 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplE PE=3 SV=1 14 133 6.0E-10
sp|B0U0X7|RL5_FRAP2 50S ribosomal protein L5 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplE PE=3 SV=1 7 133 6.0E-10
sp|Q8K962|RL5_BUCAP 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplE PE=3 SV=1 10 141 7.0E-10
sp|Q3SLN7|RL5_THIDA 50S ribosomal protein L5 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplE PE=3 SV=1 10 133 7.0E-10
sp|Q889V9|RL5_PSESM 50S ribosomal protein L5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplE PE=3 SV=1 5 133 7.0E-10
sp|C6DG62|RL5_PECCP 50S ribosomal protein L5 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplE PE=3 SV=1 1 133 7.0E-10
sp|A4VSG6|RL5_STRSY 50S ribosomal protein L5 OS=Streptococcus suis (strain 05ZYH33) GN=rplE PE=3 SV=1 14 133 7.0E-10
sp|A4VYQ5|RL5_STRS2 50S ribosomal protein L5 OS=Streptococcus suis (strain 98HAH33) GN=rplE PE=3 SV=1 14 133 7.0E-10
sp|C5D3S9|RL5_GEOSW 50S ribosomal protein L5 OS=Geobacillus sp. (strain WCH70) GN=rplE PE=3 SV=1 10 133 7.0E-10
sp|Q7MYG3|RL5_PHOLL 50S ribosomal protein L5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplE PE=3 SV=1 7 133 8.0E-10
sp|Q2LQA8|RL5_SYNAS 50S ribosomal protein L5 OS=Syntrophus aciditrophicus (strain SB) GN=rplE PE=3 SV=1 8 127 8.0E-10
sp|B9KLA3|RL5_RHOSK 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplE PE=3 SV=1 8 133 8.0E-10
sp|Q3J5R0|RL5_RHOS4 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplE PE=3 SV=1 8 133 8.0E-10
sp|A1JS20|RL5_YERE8 50S ribosomal protein L5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplE PE=3 SV=1 1 133 9.0E-10
sp|Q12SU7|RL5_SHEDO 50S ribosomal protein L5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplE PE=3 SV=1 7 127 9.0E-10
sp|Q04G73|RL5_OENOB 50S ribosomal protein L5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplE PE=3 SV=1 10 133 9.0E-10
sp|A3PGM3|RL5_RHOS1 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplE PE=3 SV=1 8 133 9.0E-10
sp|Q5PA70|RL5_ANAMM 50S ribosomal protein L5 OS=Anaplasma marginale (strain St. Maries) GN=rplE PE=3 SV=1 1 127 1.0E-09
sp|B9KJ58|RL5_ANAMF 50S ribosomal protein L5 OS=Anaplasma marginale (strain Florida) GN=rplE PE=3 SV=1 1 127 1.0E-09
sp|Q3IJJ7|RL5_PSEHT 50S ribosomal protein L5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplE PE=3 SV=1 15 127 1.0E-09
sp|A7GJ62|RL5_CLOBL 50S ribosomal protein L5 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|B1IGE2|RL5_CLOBK 50S ribosomal protein L5 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|C1FMT9|RL5_CLOBJ 50S ribosomal protein L5 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|A5I7J4|RL5_CLOBH 50S ribosomal protein L5 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|C3KVN9|RL5_CLOB6 50S ribosomal protein L5 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|A7FZ57|RL5_CLOB1 50S ribosomal protein L5 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|A5V5Z0|RL5_SPHWW 50S ribosomal protein L5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplE PE=3 SV=1 8 133 1.0E-09
sp|Q1QDH4|RL5_PSYCK 50S ribosomal protein L5 OS=Psychrobacter cryohalolentis (strain K5) GN=rplE PE=3 SV=1 8 127 1.0E-09
sp|C1CPA0|RL5_STRZT 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|C1CIA9|RL5_STRZP 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain P1031) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|C1CC18|RL5_STRZJ 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain JJA) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|Q8CWV4|RL5_STRR6 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B2IS52|RL5_STRPS 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|Q97SV1|RL5_STRPN 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B8ZKG9|RL5_STRPJ 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B1I8L0|RL5_STRPI 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|C1CAM4|RL5_STRP7 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain 70585) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B5E6G7|RL5_STRP4 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|Q04MM4|RL5_STRP2 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B1I1K0|RL5_DESAP 50S ribosomal protein L5 OS=Desulforudis audaxviator (strain MP104C) GN=rplE PE=3 SV=1 1 128 1.0E-09
sp|Q6AD07|RL5_LEIXX 50S ribosomal protein L5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplE PE=3 SV=1 17 133 1.0E-09
sp|B4RT40|RL5_ALTMD 50S ribosomal protein L5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplE PE=3 SV=1 10 127 1.0E-09
sp|Q8DS25|RL5_STRMU 50S ribosomal protein L5 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplE PE=3 SV=1 14 133 1.0E-09
sp|B8D837|RL5_BUCAT 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplE PE=3 SV=1 10 133 1.0E-09
sp|P57579|RL5_BUCAI 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplE PE=3 SV=1 10 133 1.0E-09
sp|B8D9T5|RL5_BUCA5 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplE PE=3 SV=1 10 133 1.0E-09
sp|B2VK52|RL5_ERWT9 50S ribosomal protein L5 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplE PE=3 SV=1 1 133 1.0E-09
sp|P46178|RL5_BUCAK 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplE PE=3 SV=1 1 133 1.0E-09
sp|Q4FUE4|RL5_PSYA2 50S ribosomal protein L5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplE PE=3 SV=1 8 127 1.0E-09
sp|Q74L78|RL5_LACJO 50S ribosomal protein L5 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|Q7VTB9|RL5_BORPE 50S ribosomal protein L5 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q7W2E3|RL5_BORPA 50S ribosomal protein L5 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q7WRB1|RL5_BORBR 50S ribosomal protein L5 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q046B3|RL5_LACGA 50S ribosomal protein L5 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|A9NEE5|RL5_ACHLI 50S ribosomal protein L5 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q6LVA4|RL5_PHOPR 50S ribosomal protein L5 OS=Photobacterium profundum GN=rplE PE=3 SV=1 10 127 2.0E-09
sp|Q1LTC6|RL5_BAUCH 50S ribosomal protein L5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q3A9S8|RL5_CARHZ 50S ribosomal protein L5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplE PE=3 SV=1 8 133 2.0E-09
sp|A7MPH6|RL5_CROS8 50S ribosomal protein L5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|A6LPS3|RL5_CLOB8 50S ribosomal protein L5 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplE PE=3 SV=1 8 133 2.0E-09
sp|A3CK75|RL5_STRSV 50S ribosomal protein L5 OS=Streptococcus sanguinis (strain SK36) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|Q7NEG4|RL5_GLOVI 50S ribosomal protein L5 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplE PE=3 SV=1 7 133 2.0E-09
sp|A5WCK2|RL5_PSYWF 50S ribosomal protein L5 OS=Psychrobacter sp. (strain PRwf-1) GN=rplE PE=3 SV=1 8 127 2.0E-09
sp|Q7MPH6|RL5_VIBVY 50S ribosomal protein L5 OS=Vibrio vulnificus (strain YJ016) GN=rplE PE=3 SV=1 10 127 2.0E-09
sp|Q8DE51|RL5_VIBVU 50S ribosomal protein L5 OS=Vibrio vulnificus (strain CMCP6) GN=rplE PE=3 SV=2 10 127 2.0E-09
sp|A8AZL3|RL5_STRGC 50S ribosomal protein L5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplE PE=3 SV=1 14 133 2.0E-09
sp|B3WAK5|RL5_LACCB 50S ribosomal protein L5 OS=Lactobacillus casei (strain BL23) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q034Z5|RL5_LACC3 50S ribosomal protein L5 OS=Lactobacillus casei (strain ATCC 334) GN=rplE PE=3 SV=1 10 133 2.0E-09
sp|Q3YWV1|RL5_SHISS 50S ribosomal protein L5 OS=Shigella sonnei (strain Ss046) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q0SZZ4|RL5_SHIF8 50S ribosomal protein L5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q32B43|RL5_SHIDS 50S ribosomal protein L5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q31VW8|RL5_SHIBS 50S ribosomal protein L5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B2U2S6|RL5_SHIB3 50S ribosomal protein L5 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|A6TEW0|RL5_KLEP7 50S ribosomal protein L5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B7LRS4|RL5_ESCF3 50S ribosomal protein L5 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|Q1R620|RL5_ECOUT 50S ribosomal protein L5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B1LHC2|RL5_ECOSM 50S ribosomal protein L5 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B6I222|RL5_ECOSE 50S ribosomal protein L5 OS=Escherichia coli (strain SE11) GN=rplE PE=3 SV=1 1 133 2.0E-09
sp|B7NDS9|RL5_ECOLU 50S ribosomal protein L5 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplE PE=3 SV=1 1 133 2.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7324 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4916
Ophiocordyceps camponoti-floridani Ophcf2|07312
Ophiocordyceps camponoti-rufipedis Ophun1|4449
Ophiocordyceps kimflemingae Ophio5|875
Ophiocordyceps subramaniannii Hirsu2|10386

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7324
MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKIAVHVTVRGP
KAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVTRRRRMKARIG
SSHRIKRDETVKWFKQRFDGIVR*
Coding >OphauG2|7324
ATGGCTTCCGAAAAGGCAAACAACCCCATGCGGGAGCTCAAGATCCAGAAGCTTGTTCTGAATATTTCCGTCGGC
GAGTCTGGTGACAGACTGACCCGAGCCGCCAAGGTGCTCGAGCAGCTGTCGGGTCAGACGCCCGTCTACAGCAAG
GCTCGCTACACCGTCCGTACCTTTGGTATCCGTCGTAACGAAAAGATTGCTGTCCACGTTACTGTCCGTGGCCCC
AAGGCCGAGGAGATTCTCGAGCGTGGCCTCAAGGTTAAGGAATATGAACTTCGCAAGCGCAACTTTTCCGAGACG
GGCAACTTTGGCTTTGGCATCAGCGAACACATTGACCTGGGCATCAAGTACGACCCCTCAATTGGTATCTACGGC
ATGGACTTTTACTGCTGCATGACCCGCCCTGGTGAGCGCGTCACTCGCCGCCGCCGCATGAAGGCCAGAATTGGA
TCTAGCCACCGCATCAAGCGCGATGAGACTGTCAAGTGGTTCAAGCAGCGTTTCGACGGCATTGTTCGGTAG
Transcript >OphauG2|7324
ATGGCTTCCGAAAAGGCAAACAACCCCATGCGGGAGCTCAAGATCCAGAAGCTTGTTCTGAATATTTCCGTCGGC
GAGTCTGGTGACAGACTGACCCGAGCCGCCAAGGTGCTCGAGCAGCTGTCGGGTCAGACGCCCGTCTACAGCAAG
GCTCGCTACACCGTCCGTACCTTTGGTATCCGTCGTAACGAAAAGATTGCTGTCCACGTTACTGTCCGTGGCCCC
AAGGCCGAGGAGATTCTCGAGCGTGGCCTCAAGGTTAAGGAATATGAACTTCGCAAGCGCAACTTTTCCGAGACG
GGCAACTTTGGCTTTGGCATCAGCGAACACATTGACCTGGGCATCAAGTACGACCCCTCAATTGGTATCTACGGC
ATGGACTTTTACTGCTGCATGACCCGCCCTGGTGAGCGCGTCACTCGCCGCCGCCGCATGAAGGCCAGAATTGGA
TCTAGCCACCGCATCAAGCGCGATGAGACTGTCAAGTGGTTCAAGCAGCGTTTCGACGGCATTGTTCGGTAG
Gene >OphauG2|7324
ATGGCTTCCGAAAAGGCAAACAACCCCATGCGGGAGCTCAAGATCCAGAAGCTTGTTCTGAATATTTCCGTCGGC
GAGTCTGGTGACAGACTGACCCGAGCCGCCAAGGTGCTCGAGCAGCTGTCGGGTCAGACGCCCGTCTACAGTACG
TTGTGTCCAAGTATTGAGGCAGCATGCAATCTGACCTTGACTCCTCAGGCAAGGCTCGCTACACCGTCCGTACCT
TTGGTATCCGTCGTAACGAAAAGATTGCTGTCCACGTTACTGTCCGTGGCCCCAAGGTACGTTGGCCAAAGCTAG
GCCCCAGCATCCTTTACAAGGCTATAATCTGACGAGCCATGATGCAGGCCGAGGAGATTCTCGAGCGTGGCCTCA
AGGTTAAGGAATATGAACTTCGCAAGCGCAACTTTTCCGAGACGGGCAACTTTGGCTTTGGCATCAGCGAACACA
TTGACCTGGGCATCAAGTACGACCCCTCAATTGGTATCTACGGCATGGACTTTTACTGCTGCATGACCCGCCCTG
GTGAGCGCGTCACTCGCCGCCGCCGCATGAAGGCCAGAATTGGATCTAGCCACCGCATCAAGCGCGATGAGACTG
TCAAGTGGTTCAAGCAGCGTTTCGACGGCATTGTTCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail