Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7321
Gene name
LocationContig_84:18397..19149
Strand-
Gene length (bp)752
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00306 ATP-synt_ab_C ATP synthase alpha/beta chain, C terminal domain 2.2E-47 99 223
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 1.3E-28 1 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37211|ATPA_NEUCR ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-1 PE=3 SV=1 1 229 1.0E-142
sp|P49375|ATPA_KLULA ATP synthase subunit alpha, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP1 PE=1 SV=1 1 228 2.0E-120
sp|P24487|ATPA_SCHPO ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp1 PE=3 SV=1 1 228 5.0E-120
sp|P07251|ATPA_YEAST ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 1 228 2.0E-118
sp|Q9XXK1|ATPA_CAEEL ATP synthase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=H28O16.1 PE=1 SV=1 1 228 2.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37211|ATPA_NEUCR ATP synthase subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-1 PE=3 SV=1 1 229 1.0E-142
sp|P49375|ATPA_KLULA ATP synthase subunit alpha, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP1 PE=1 SV=1 1 228 2.0E-120
sp|P24487|ATPA_SCHPO ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp1 PE=3 SV=1 1 228 5.0E-120
sp|P07251|ATPA_YEAST ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 1 228 2.0E-118
sp|Q9XXK1|ATPA_CAEEL ATP synthase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=H28O16.1 PE=1 SV=1 1 228 2.0E-115
sp|P08428|ATPA_XENLA ATP synthase subunit alpha, mitochondrial OS=Xenopus laevis GN=atp5a PE=2 SV=1 1 228 3.0E-115
sp|Q5R546|ATPA_PONAB ATP synthase subunit alpha, mitochondrial OS=Pongo abelii GN=ATP5A1 PE=2 SV=1 1 228 8.0E-115
sp|A5A6H5|ATPA_PANTR ATP synthase subunit alpha, mitochondrial OS=Pan troglodytes GN=ATP5A1 PE=2 SV=1 1 228 1.0E-114
sp|P25705|ATPA_HUMAN ATP synthase subunit alpha, mitochondrial OS=Homo sapiens GN=ATP5A1 PE=1 SV=1 1 228 1.0E-114
sp|P15999|ATPA_RAT ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Atp5a1 PE=1 SV=2 1 228 1.0E-114
sp|Q03265|ATPA_MOUSE ATP synthase subunit alpha, mitochondrial OS=Mus musculus GN=Atp5a1 PE=1 SV=1 1 228 3.0E-114
sp|P19483|ATPA_BOVIN ATP synthase subunit alpha, mitochondrial OS=Bos taurus GN=ATP5A1 PE=1 SV=1 1 228 5.0E-114
sp|P80021|ATPA_PIG ATP synthase subunit alpha, mitochondrial OS=Sus scrofa GN=ATP5A1 PE=1 SV=2 1 228 7.0E-114
sp|P35381|ATPA_DROME ATP synthase subunit alpha, mitochondrial OS=Drosophila melanogaster GN=blw PE=1 SV=2 1 228 9.0E-114
sp|C3M9S3|ATPA_RHISN ATP synthase subunit alpha OS=Rhizobium sp. (strain NGR234) GN=atpA PE=3 SV=1 1 228 4.0E-110
sp|A5V3X3|ATPA_SPHWW ATP synthase subunit alpha OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpA PE=3 SV=1 1 228 1.0E-109
sp|Q8UC74|ATPA_AGRFC ATP synthase subunit alpha OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpA PE=3 SV=1 1 228 2.0E-109
sp|Q0BQE6|ATPA_GRABC ATP synthase subunit alpha OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpA PE=3 SV=1 1 228 2.0E-109
sp|A7IH29|ATPA_XANP2 ATP synthase subunit alpha OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpA PE=3 SV=1 1 228 3.0E-109
sp|B0THN4|ATPA_HELMI ATP synthase subunit alpha OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpA PE=3 SV=1 1 230 3.0E-109
sp|A7HT50|ATPA_PARL1 ATP synthase subunit alpha OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpA PE=3 SV=1 1 228 1.0E-108
sp|A6WXW9|ATPA_OCHA4 ATP synthase subunit alpha OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpA PE=3 SV=1 1 228 1.0E-108
sp|A6UDM3|ATPA_SINMW ATP synthase subunit alpha OS=Sinorhizobium medicae (strain WSM419) GN=atpA PE=3 SV=1 1 228 1.0E-108
sp|Q21CY5|ATPA_RHOPB ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB18) GN=atpA PE=3 SV=1 1 228 1.0E-108
sp|B8IN03|ATPA_METNO ATP synthase subunit alpha OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpA PE=3 SV=1 1 228 2.0E-108
sp|Q92LK6|ATPA_RHIME ATP synthase subunit alpha OS=Rhizobium meliloti (strain 1021) GN=atpA PE=3 SV=1 1 228 2.0E-108
sp|Q98EV6|ATPA_RHILO ATP synthase subunit alpha OS=Rhizobium loti (strain MAFF303099) GN=atpA PE=3 SV=1 1 228 2.0E-108
sp|Q57B86|ATPA_BRUAB ATP synthase subunit alpha OS=Brucella abortus biovar 1 (strain 9-941) GN=atpA PE=3 SV=1 1 229 7.0E-108
sp|Q2YLI5|ATPA_BRUA2 ATP synthase subunit alpha OS=Brucella abortus (strain 2308) GN=atpA PE=3 SV=1 1 229 7.0E-108
sp|B2S7M5|ATPA_BRUA1 ATP synthase subunit alpha OS=Brucella abortus (strain S19) GN=atpA PE=3 SV=1 1 229 7.0E-108
sp|Q8YJ37|ATPA_BRUME ATP synthase subunit alpha OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpA PE=3 SV=1 1 228 9.0E-108
sp|C0RF52|ATPA_BRUMB ATP synthase subunit alpha OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpA PE=3 SV=1 1 228 9.0E-108
sp|A9WWS4|ATPA_BRUSI ATP synthase subunit alpha OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpA PE=3 SV=1 1 228 9.0E-108
sp|A9M839|ATPA_BRUC2 ATP synthase subunit alpha OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpA PE=3 SV=1 1 228 9.0E-108
sp|Q07UZ3|ATPA_RHOP5 ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisA53) GN=atpA PE=3 SV=1 1 228 1.0E-107
sp|A5VSE3|ATPA_BRUO2 ATP synthase subunit alpha OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpA PE=3 SV=1 1 228 1.0E-107
sp|Q1MAZ0|ATPA_RHIL3 ATP synthase subunit alpha OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpA PE=3 SV=1 1 228 1.0E-107
sp|Q3A944|ATPA_CARHZ ATP synthase subunit alpha OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpA PE=3 SV=1 1 228 1.0E-107
sp|Q2J3I2|ATPA_RHOP2 ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain HaA2) GN=atpA PE=3 SV=1 1 228 2.0E-107
sp|B5ZSN9|ATPA_RHILW ATP synthase subunit alpha OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpA PE=3 SV=1 1 228 2.0E-107
sp|Q13DP4|ATPA_RHOPS ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB5) GN=atpA PE=3 SV=1 1 228 2.0E-107
sp|Q2N8Z5|ATPA_ERYLH ATP synthase subunit alpha OS=Erythrobacter litoralis (strain HTCC2594) GN=atpA PE=3 SV=1 1 228 2.0E-107
sp|A8HS15|ATPA_AZOC5 ATP synthase subunit alpha OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpA PE=3 SV=1 1 228 4.0E-107
sp|Q8FYR3|ATPA_BRUSU ATP synthase subunit alpha OS=Brucella suis biovar 1 (strain 1330) GN=atpA PE=3 SV=1 1 228 4.0E-107
sp|B3PQ70|ATPA_RHIE6 ATP synthase subunit alpha OS=Rhizobium etli (strain CIAT 652) GN=atpA PE=3 SV=1 1 228 5.0E-107
sp|Q89X72|ATPA_BRADU ATP synthase subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpA PE=3 SV=1 1 228 5.0E-107
sp|Q2K3G8|ATPA_RHIEC ATP synthase subunit alpha OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=atpA PE=3 SV=1 1 228 7.0E-107
sp|Q2VZN0|ATPA_MAGSA ATP synthase subunit alpha OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpA PE=3 SV=1 1 228 2.0E-106
sp|Q5NQZ1|ATPA_ZYMMO ATP synthase subunit alpha OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpA PE=3 SV=1 1 228 2.0E-106
sp|Q1QQS5|ATPA_NITHX ATP synthase subunit alpha OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpA PE=3 SV=1 1 229 2.0E-106
sp|Q3SVJ4|ATPA_NITWN ATP synthase subunit alpha OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpA PE=3 SV=1 1 228 3.0E-106
sp|Q2G5N7|ATPA_NOVAD ATP synthase subunit alpha OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpA PE=3 SV=1 1 228 3.0E-106
sp|B9JTR4|ATPA_AGRVS ATP synthase subunit alpha OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpA PE=3 SV=1 1 228 4.0E-106
sp|B0UE41|ATPA_METS4 ATP synthase subunit alpha OS=Methylobacterium sp. (strain 4-46) GN=atpA PE=3 SV=1 1 228 4.0E-106
sp|Q11DD7|ATPA_CHESB ATP synthase subunit alpha OS=Chelativorans sp. (strain BNC1) GN=atpA PE=3 SV=1 1 228 6.0E-106
sp|Q4FP36|ATPA_PELUB ATP synthase subunit alpha OS=Pelagibacter ubique (strain HTCC1062) GN=atpA PE=3 SV=1 1 230 6.0E-106
sp|Q6NDD0|ATPA_RHOPA ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpA PE=3 SV=1 1 228 9.0E-106
sp|B8CZ12|ATPA_HALOH ATP synthase subunit alpha OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpA PE=3 SV=1 1 228 2.0E-105
sp|Q0AKV8|ATPA_MARMM ATP synthase subunit alpha OS=Maricaulis maris (strain MCS10) GN=atpA PE=3 SV=1 1 228 3.0E-105
sp|B8EQP9|ATPA_METSB ATP synthase subunit alpha OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=atpA PE=3 SV=1 1 228 3.0E-104
sp|B6JD06|ATPA_OLICO ATP synthase subunit alpha OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=atpA PE=3 SV=1 1 228 3.0E-104
sp|B1LVH1|ATPA_METRJ ATP synthase subunit alpha OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=atpA PE=3 SV=1 1 228 6.0E-104
sp|B1ZEE9|ATPA_METPB ATP synthase subunit alpha OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpA PE=3 SV=1 1 228 6.0E-104
sp|A5FZ52|ATPA_ACICJ ATP synthase subunit alpha OS=Acidiphilium cryptum (strain JF-5) GN=atpA PE=3 SV=1 1 228 8.0E-104
sp|Q2RFX7|ATPA_MOOTA ATP synthase subunit alpha OS=Moorella thermoacetica (strain ATCC 39073) GN=atpA PE=1 SV=1 1 228 8.0E-104
sp|A5E948|ATPA_BRASB ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpA PE=3 SV=1 1 228 9.0E-104
sp|P05036|ATPA_RHORU ATP synthase subunit alpha OS=Rhodospirillum rubrum GN=atpA PE=1 SV=1 1 228 1.0E-103
sp|Q2RV20|ATPA_RHORT ATP synthase subunit alpha OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpA PE=3 SV=1 1 228 1.0E-103
sp|P26854|ATPAM_MARPO ATP synthase subunit alpha, mitochondrial OS=Marchantia polymorpha GN=ATPA PE=3 SV=2 1 230 1.0E-103
sp|A4YKD8|ATPA_BRASO ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain ORS278) GN=atpA PE=3 SV=1 1 228 2.0E-103
sp|B9KPI6|ATPA_RHOSK ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpA PE=3 SV=1 1 203 4.0E-103
sp|Q3J433|ATPA_RHOS4 ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpA PE=3 SV=1 1 203 4.0E-103
sp|A3PIB7|ATPA1_RHOS1 ATP synthase subunit alpha 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpA1 PE=3 SV=1 1 203 4.0E-103
sp|A4WUM9|ATPA_RHOS5 ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpA PE=3 SV=1 1 203 5.0E-103
sp|Q5FRC7|ATPA1_GLUOX ATP synthase subunit alpha 1 OS=Gluconobacter oxydans (strain 621H) GN=atpA1 PE=3 SV=1 1 228 5.0E-103
sp|Q0AUD1|ATPA_SYNWW ATP synthase subunit alpha OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=atpA PE=3 SV=1 1 228 6.0E-103
sp|Q9A2V7|ATPA_CAUCR ATP synthase subunit alpha OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpA PE=3 SV=1 1 228 6.0E-103
sp|B8H5I2|ATPA_CAUCN ATP synthase subunit alpha OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=atpA PE=3 SV=1 1 228 6.0E-103
sp|A9W2R3|ATPA_METEP ATP synthase subunit alpha OS=Methylobacterium extorquens (strain PA1) GN=atpA PE=3 SV=1 1 228 7.0E-103
sp|B7KUA4|ATPA_METC4 ATP synthase subunit alpha OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpA PE=3 SV=1 1 228 7.0E-103
sp|B0T338|ATPA_CAUSK ATP synthase subunit alpha OS=Caulobacter sp. (strain K31) GN=atpA PE=3 SV=1 1 228 8.0E-103
sp|A1UR47|ATPA_BARBK ATP synthase subunit alpha OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpA PE=3 SV=1 1 228 1.0E-102
sp|A8LJR6|ATPA2_DINSH ATP synthase subunit alpha 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpA2 PE=3 SV=1 1 224 2.0E-102
sp|Q6FYM1|ATPA_BARQU ATP synthase subunit alpha OS=Bartonella quintana (strain Toulouse) GN=atpA PE=3 SV=1 1 228 2.0E-102
sp|Q5LNN9|ATPA_RUEPO ATP synthase subunit alpha OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpA PE=3 SV=1 1 228 2.0E-102
sp|A1B8N8|ATPA_PARDP ATP synthase subunit alpha OS=Paracoccus denitrificans (strain Pd 1222) GN=atpA PE=1 SV=1 1 217 4.0E-102
sp|A0LDA2|ATPA_MAGMM ATP synthase subunit alpha OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpA PE=3 SV=1 1 230 5.0E-102
sp|A9IYX0|ATPA_BART1 ATP synthase subunit alpha OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpA PE=3 SV=1 1 228 6.0E-102
sp|A8GTS8|ATPA_RICRS ATP synthase subunit alpha OS=Rickettsia rickettsii (strain Sheila Smith) GN=atpA PE=3 SV=1 1 229 8.0E-102
sp|B0BVB8|ATPA_RICRO ATP synthase subunit alpha OS=Rickettsia rickettsii (strain Iowa) GN=atpA PE=3 SV=2 1 229 8.0E-102
sp|Q24MN9|ATPA_DESHY ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain Y51) GN=atpA PE=3 SV=1 1 229 1.0E-101
sp|Q28TJ8|ATPA_JANSC ATP synthase subunit alpha OS=Jannaschia sp. (strain CCS1) GN=atpA PE=3 SV=1 1 224 1.0E-101
sp|Q1GQS7|ATPA_SPHAL ATP synthase subunit alpha OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpA PE=3 SV=1 1 228 2.0E-101
sp|A8F2U2|ATPA_RICM5 ATP synthase subunit alpha OS=Rickettsia massiliae (strain Mtu5) GN=atpA PE=3 SV=2 1 229 2.0E-101
sp|Q4UK16|ATPA_RICFE ATP synthase subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=atpA PE=3 SV=1 1 229 2.0E-101
sp|Q92G86|ATPA_RICCN ATP synthase subunit alpha OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=atpA PE=3 SV=2 1 229 3.0E-101
sp|A5CYE4|ATPA_PELTS ATP synthase subunit alpha OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpA PE=3 SV=1 1 228 4.0E-101
sp|Q6G1W7|ATPA_BARHE ATP synthase subunit alpha OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpA PE=3 SV=1 1 228 5.0E-101
sp|B8FZ36|ATPA_DESHD ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpA PE=3 SV=1 1 229 8.0E-101
sp|A8GY42|ATPA_RICB8 ATP synthase subunit alpha OS=Rickettsia bellii (strain OSU 85-389) GN=atpA PE=3 SV=1 1 229 9.0E-101
sp|C4K229|ATPA_RICPU ATP synthase subunit alpha OS=Rickettsia peacockii (strain Rustic) GN=atpA PE=3 SV=1 1 229 1.0E-100
sp|B3CSS9|ATPA_ORITI ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Ikeda) GN=atpA PE=3 SV=1 1 228 1.0E-100
sp|A8GPZ6|ATPA_RICAH ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1 1 229 1.0E-100
sp|A9H9A4|ATPA_GLUDA ATP synthase subunit alpha OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpA PE=3 SV=1 1 228 1.0E-100
sp|O50288|ATPA_RICPR ATP synthase subunit alpha OS=Rickettsia prowazekii (strain Madrid E) GN=atpA PE=3 SV=2 1 229 2.0E-100
sp|P72245|ATPA_RHOCA ATP synthase subunit alpha OS=Rhodobacter capsulatus GN=atpA PE=1 SV=3 1 228 2.0E-100
sp|Q0C0Z8|ATPA_HYPNA ATP synthase subunit alpha OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpA PE=3 SV=1 1 228 4.0E-100
sp|Q01915|ATPAM_SOYBN ATP synthase subunit alpha, mitochondrial OS=Glycine max GN=ATPA PE=3 SV=1 1 203 6.0E-100
sp|Q5HC95|ATPA_EHRRW ATP synthase subunit alpha OS=Ehrlichia ruminantium (strain Welgevonden) GN=atpA PE=3 SV=1 1 211 8.0E-100
sp|Q5FF66|ATPA_EHRRG ATP synthase subunit alpha OS=Ehrlichia ruminantium (strain Gardel) GN=atpA PE=3 SV=1 1 211 8.0E-100
sp|Q68VU6|ATPA_RICTY ATP synthase subunit alpha OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=atpA PE=3 SV=1 1 229 1.0E-99
sp|P24459|ATPAM_PHAVU ATP synthase subunit alpha, mitochondrial OS=Phaseolus vulgaris GN=ATPA PE=3 SV=1 1 203 2.0E-99
sp|P0C522|ATPAM_ORYSJ ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=ATPA PE=1 SV=1 1 226 2.0E-99
sp|P0C521|ATPAM_ORYSI ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica GN=ATPA PE=3 SV=1 1 226 2.0E-99
sp|P0C520|ATPAM_ORYSA ATP synthase subunit alpha, mitochondrial OS=Oryza sativa GN=ATPA PE=3 SV=1 1 226 2.0E-99
sp|A8F006|ATPA_RICCK ATP synthase subunit alpha OS=Rickettsia canadensis (strain McKiel) GN=atpA PE=3 SV=1 1 229 2.0E-99
sp|P05493|ATPAM_PEA ATP synthase subunit alpha, mitochondrial OS=Pisum sativum GN=ATPA PE=3 SV=2 1 203 2.0E-99
sp|A8MJW1|ATPA_ALKOO ATP synthase subunit alpha OS=Alkaliphilus oremlandii (strain OhILAs) GN=atpA PE=3 SV=1 1 228 5.0E-99
sp|Q1GEU6|ATPA_RUEST ATP synthase subunit alpha OS=Ruegeria sp. (strain TM1040) GN=atpA PE=3 SV=1 1 206 5.0E-99
sp|A5CD07|ATPA_ORITB ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Boryong) GN=atpA PE=3 SV=1 1 228 7.0E-99
sp|P92549|ATPAM_ARATH ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=ATPA PE=1 SV=2 1 200 7.0E-99
sp|Q313V8|ATPA_DESAG ATP synthase subunit alpha OS=Desulfovibrio alaskensis (strain G20) GN=atpA PE=3 SV=1 1 230 8.0E-99
sp|Q0I7R2|ATPA_SYNS3 ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9311) GN=atpA PE=3 SV=1 1 230 9.0E-99
sp|Q4G397|ATPA_EMIHU ATP synthase subunit alpha, chloroplastic OS=Emiliania huxleyi GN=atpA PE=3 SV=1 1 220 2.0E-98
sp|Q7VJ23|ATPA_HELHP ATP synthase subunit alpha OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=atpA PE=3 SV=1 1 228 3.0E-98
sp|Q162S7|ATPA_ROSDO ATP synthase subunit alpha OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpA PE=3 SV=1 1 228 3.0E-98
sp|P05492|ATPAM_OENBI ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis GN=ATPA PE=3 SV=1 1 226 5.0E-98
sp|Q7U8W5|ATPA_SYNPX ATP synthase subunit alpha OS=Synechococcus sp. (strain WH8102) GN=atpA PE=3 SV=1 1 230 7.0E-98
sp|P05439|ATPA_RHOBL ATP synthase subunit alpha OS=Rhodobacter blasticus GN=atpA PE=3 SV=1 1 228 8.0E-98
sp|B9DX63|ATPA_CLOK1 ATP synthase subunit alpha OS=Clostridium kluyveri (strain NBRC 12016) GN=atpA PE=3 SV=1 1 229 9.0E-98
sp|P05494|ATPAM_MAIZE ATP synthase subunit alpha, mitochondrial OS=Zea mays GN=ATPA PE=3 SV=1 1 211 1.0E-97
sp|B8J437|ATPA_DESDA ATP synthase subunit alpha OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=atpA PE=3 SV=1 1 228 1.0E-97
sp|B8FGT6|ATPA_DESAA ATP synthase subunit alpha OS=Desulfatibacillum alkenivorans (strain AK-01) GN=atpA PE=3 SV=1 1 228 2.0E-97
sp|Q318U1|ATPA_PROM9 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9312) GN=atpA PE=3 SV=1 1 230 2.0E-97
sp|O66907|ATPA_AQUAE ATP synthase subunit alpha OS=Aquifex aeolicus (strain VF5) GN=atpA PE=3 SV=1 1 229 2.0E-97
sp|B4RD45|ATPA_PHEZH ATP synthase subunit alpha OS=Phenylobacterium zucineum (strain HLK1) GN=atpA PE=3 SV=1 1 228 3.0E-97
sp|B9L1H1|ATPA_THERP ATP synthase subunit alpha OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=atpA PE=3 SV=1 1 230 4.0E-97
sp|A5GNC8|ATPA_SYNPW ATP synthase subunit alpha OS=Synechococcus sp. (strain WH7803) GN=atpA PE=3 SV=1 1 230 4.0E-97
sp|Q8DLP3|ATPA_THEEB ATP synthase subunit alpha OS=Thermosynechococcus elongatus (strain BP-1) GN=atpA PE=1 SV=1 1 228 5.0E-97
sp|B5YI22|ATPA_THEYD ATP synthase subunit alpha OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=atpA PE=3 SV=1 1 228 7.0E-97
sp|A0LLG0|ATPA_SYNFM ATP synthase subunit alpha OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=atpA PE=3 SV=1 1 228 7.0E-97
sp|B1I6J9|ATPA_DESAP ATP synthase subunit alpha OS=Desulforudis audaxviator (strain MP104C) GN=atpA PE=3 SV=1 1 230 8.0E-97
sp|Q6AQ12|ATPA_DESPS ATP synthase subunit alpha OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=atpA PE=3 SV=1 1 228 8.0E-97
sp|Q39ZT9|ATPA1_PELCD ATP synthase subunit alpha 1/3 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpA1 PE=3 SV=1 1 228 9.0E-97
sp|B7IG42|ATPA_THEAB ATP synthase subunit alpha OS=Thermosipho africanus (strain TCF52B) GN=atpA PE=3 SV=1 1 229 1.0E-96
sp|B8DRD0|ATPA_DESVM ATP synthase subunit alpha OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=atpA PE=3 SV=1 1 228 1.0E-96
sp|Q3AZM1|ATPA_SYNS9 ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9902) GN=atpA PE=3 SV=1 1 230 1.0E-96
sp|Q31RF1|ATPA_SYNE7 ATP synthase subunit alpha OS=Synechococcus elongatus (strain PCC 7942) GN=atpA PE=3 SV=1 1 230 1.0E-96
sp|P08449|ATPA_SYNP6 ATP synthase subunit alpha OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=atpA PE=3 SV=1 1 230 2.0E-96
sp|A5N3H9|ATPA_CLOK5 ATP synthase subunit alpha OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpA PE=3 SV=1 1 229 2.0E-96
sp|A8G6V1|ATPA_PROM2 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9215) GN=atpA PE=3 SV=1 1 230 2.0E-96
sp|B8HPK1|ATPA_CYAP4 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=atpA PE=3 SV=1 1 230 3.0E-96
sp|A1ALL5|ATPA_PELPD ATP synthase subunit alpha OS=Pelobacter propionicus (strain DSM 2379) GN=atpA1 PE=3 SV=1 1 228 3.0E-96
sp|C5CIV6|ATPA_KOSOT ATP synthase subunit alpha OS=Kosmotoga olearia (strain TBF 19.5.1) GN=atpA PE=3 SV=1 1 230 3.0E-96
sp|A2BT25|ATPA_PROMS ATP synthase subunit alpha OS=Prochlorococcus marinus (strain AS9601) GN=atpA PE=3 SV=1 1 230 4.0E-96
sp|A3PET9|ATPA_PROM0 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9301) GN=atpA PE=3 SV=1 1 230 4.0E-96
sp|A6LJR3|ATPA_THEM4 ATP synthase subunit alpha OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=atpA PE=3 SV=1 1 229 4.0E-96
sp|B4U989|ATPA_HYDS0 ATP synthase subunit alpha OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=atpA PE=3 SV=1 1 229 4.0E-96
sp|A7HIX9|ATPA_ANADF ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpA PE=3 SV=1 1 217 4.0E-96
sp|A9BFX5|ATPA_PETMO ATP synthase subunit alpha OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=atpA PE=3 SV=1 1 228 4.0E-96
sp|Q2IHQ9|ATPA_ANADE ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpA PE=3 SV=1 1 212 4.0E-96
sp|Q3YT21|ATPA_EHRCJ ATP synthase subunit alpha OS=Ehrlichia canis (strain Jake) GN=atpA PE=3 SV=1 1 203 4.0E-96
sp|B3EA03|ATPA_GEOLS ATP synthase subunit alpha OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpA PE=3 SV=1 1 228 5.0E-96
sp|O78475|ATPA_GUITH ATP synthase subunit alpha, chloroplastic OS=Guillardia theta GN=atpA PE=3 SV=1 1 198 5.0E-96
sp|Q7V037|ATPA_PROMP ATP synthase subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=atpA PE=3 SV=1 1 230 6.0E-96
sp|Q1ACM8|ATPA_CHAVU ATP synthase subunit alpha, chloroplastic OS=Chara vulgaris GN=atpA PE=3 SV=1 1 230 7.0E-96
sp|Q2GHX3|ATPA_EHRCR ATP synthase subunit alpha OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpA PE=3 SV=1 1 203 7.0E-96
sp|Q2GIG2|ATPA_ANAPZ ATP synthase subunit alpha OS=Anaplasma phagocytophilum (strain HZ) GN=atpA PE=3 SV=1 1 228 9.0E-96
sp|Q06GS5|ATPA_PIPCE ATP synthase subunit alpha, chloroplastic OS=Piper cenocladum GN=atpA PE=3 SV=1 1 229 1.0E-95
sp|B7KKR4|ATPA_CYAP7 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7424) GN=atpA PE=3 SV=1 1 228 1.0E-95
sp|B2HQK4|ATPA_MYCMM ATP synthase subunit alpha OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=atpA PE=3 SV=1 1 230 1.0E-95
sp|A6TK63|ATPA_ALKMQ ATP synthase subunit alpha OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpA PE=3 SV=1 1 228 1.0E-95
sp|Q2JSW1|ATPA_SYNJA ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpA PE=3 SV=1 1 230 2.0E-95
sp|P68541|ATPAM_RAPSA ATP synthase subunit alpha, mitochondrial OS=Raphanus sativus GN=ATPA PE=3 SV=1 1 200 3.0E-95
sp|P22201|ATPAM_BRANA ATP synthase subunit alpha, mitochondrial OS=Brassica napus GN=ATPA PE=3 SV=1 1 200 3.0E-95
sp|P68542|ATPAM_BRACM ATP synthase subunit alpha, mitochondrial OS=Brassica campestris GN=ATPA PE=3 SV=1 1 200 3.0E-95
sp|P27179|ATPA_SYNY3 ATP synthase subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpA PE=3 SV=1 1 228 3.0E-95
sp|Q06735|ATPAM_BETVU ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris GN=ATPA PE=3 SV=1 1 203 3.0E-95
sp|B9LZ86|ATPA_GEODF ATP synthase subunit alpha OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpA PE=3 SV=1 1 228 3.0E-95
sp|Q7VA63|ATPA_PROMA ATP synthase subunit alpha OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=atpA PE=3 SV=1 1 219 4.0E-95
sp|Q2LQZ7|ATPA1_SYNAS ATP synthase subunit alpha 1 OS=Syntrophus aciditrophicus (strain SB) GN=atpA1 PE=3 SV=1 1 230 4.0E-95
sp|A2BYH6|ATPA_PROM5 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9515) GN=atpA PE=3 SV=1 1 230 4.0E-95
sp|Q73X57|ATPA_MYCPA ATP synthase subunit alpha OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=atpA PE=3 SV=1 1 228 4.0E-95
sp|A0QCX6|ATPA_MYCA1 ATP synthase subunit alpha OS=Mycobacterium avium (strain 104) GN=atpA PE=3 SV=1 1 228 4.0E-95
sp|Q2JIG0|ATPA_SYNJB ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpA PE=3 SV=1 1 230 5.0E-95
sp|Q1AVH7|ATPA_RUBXD ATP synthase subunit alpha OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=atpA PE=3 SV=1 1 228 6.0E-95
sp|Q74GY2|ATPA_GEOSL ATP synthase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpA PE=3 SV=1 1 217 6.0E-95
sp|A0PUK2|ATPA_MYCUA ATP synthase subunit alpha OS=Mycobacterium ulcerans (strain Agy99) GN=atpA PE=3 SV=1 1 230 6.0E-95
sp|B0BZL2|ATPA1_ACAM1 ATP synthase subunit alpha 1 OS=Acaryochloris marina (strain MBIC 11017) GN=atpA1 PE=3 SV=1 1 230 7.0E-95
sp|Q39Q54|ATPA_GEOMG ATP synthase subunit alpha OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpA PE=3 SV=1 1 228 9.0E-95
sp|C4XI08|ATPA_DESMR ATP synthase subunit alpha OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=atpA PE=3 SV=1 1 228 1.0E-94
sp|A6MVW4|ATPA_RHDSA ATP synthase subunit alpha, chloroplastic OS=Rhodomonas salina GN=atpA PE=3 SV=1 1 212 1.0E-94
sp|A5GV72|ATPA_SYNR3 ATP synthase subunit alpha OS=Synechococcus sp. (strain RCC307) GN=atpA PE=3 SV=1 1 229 1.0E-94
sp|P35009|ATPA_GALSU ATP synthase subunit alpha, chloroplastic OS=Galdieria sulphuraria GN=atpA PE=3 SV=1 1 202 1.0E-94
sp|P05495|ATPAM_NICPL ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia GN=ATPA PE=3 SV=1 1 225 2.0E-94
sp|A6Q4C2|ATPA_NITSB ATP synthase subunit alpha OS=Nitratiruptor sp. (strain SB155-2) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|Q05372|ATPA_SYNP1 ATP synthase subunit alpha OS=Synechococcus sp. (strain PCC 6716) GN=atpA PE=1 SV=4 1 228 2.0E-94
sp|A1VFJ3|ATPA_DESVV ATP synthase subunit alpha OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|Q72E02|ATPA_DESVH ATP synthase subunit alpha OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|B2J058|ATPA_NOSP7 ATP synthase subunit alpha OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|Q5P9M4|ATPA_ANAMM ATP synthase subunit alpha OS=Anaplasma marginale (strain St. Maries) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|B9KH09|ATPA_ANAMF ATP synthase subunit alpha OS=Anaplasma marginale (strain Florida) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|B1MLW0|ATPA_MYCA9 ATP synthase subunit alpha OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|P9WPU7|ATPA_MYCTU ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=atpA PE=1 SV=1 1 228 2.0E-94
sp|P9WPU6|ATPA_MYCTO ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|A5U207|ATPA_MYCTA ATP synthase subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|C1AMV2|ATPA_MYCBT ATP synthase subunit alpha OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|A1KI96|ATPA_MYCBP ATP synthase subunit alpha OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|P63674|ATPA_MYCBO ATP synthase subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=atpA PE=3 SV=1 1 228 2.0E-94
sp|Q1IIG6|ATPA_KORVE ATP synthase subunit alpha OS=Koribacter versatilis (strain Ellin345) GN=atpA PE=3 SV=1 1 230 3.0E-94
sp|B8JCV2|ATPA_ANAD2 ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpA PE=3 SV=1 1 212 3.0E-94
sp|Q112Z6|ATPA_TRIEI ATP synthase subunit alpha OS=Trichodesmium erythraeum (strain IMS101) GN=atpA PE=3 SV=1 1 229 3.0E-94
sp|A0RR28|ATPA_CAMFF ATP synthase subunit alpha OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpA PE=3 SV=1 1 224 4.0E-94
sp|Q67TB9|ATPA_SYMTH ATP synthase subunit alpha OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpA PE=3 SV=1 1 222 4.0E-94
sp|A4SGM9|ATPA_CHLPM ATP synthase subunit alpha OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=atpA PE=3 SV=1 1 228 4.0E-94
sp|B9K7T9|ATPA_THENN ATP synthase subunit alpha OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=atpA PE=3 SV=1 1 228 4.0E-94
sp|A8ZU99|ATPA_DESOH ATP synthase subunit alpha OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpA PE=3 SV=1 1 211 5.0E-94
sp|Q1CWT2|ATPA_MYXXD ATP synthase subunit alpha OS=Myxococcus xanthus (strain DK 1622) GN=atpA PE=3 SV=2 1 199 5.0E-94
sp|Q07405|ATPA_MYXXA ATP synthase subunit alpha OS=Myxococcus xanthus GN=atpA PE=1 SV=1 1 199 5.0E-94
sp|B1LBC1|ATPA_THESQ ATP synthase subunit alpha OS=Thermotoga sp. (strain RQ2) GN=atpA PE=3 SV=1 1 228 5.0E-94
sp|A5ILX0|ATPA_THEP1 ATP synthase subunit alpha OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=atpA PE=3 SV=1 1 228 5.0E-94
sp|Q9X1U7|ATPA_THEMA ATP synthase subunit alpha OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=atpA PE=1 SV=1 1 228 5.0E-94
sp|P56294|ATPA_CHLVU ATP synthase subunit alpha, chloroplastic OS=Chlorella vulgaris GN=atpA PE=3 SV=1 1 230 6.0E-94
sp|Q7YJY4|ATPA_CALFG ATP synthase subunit alpha, chloroplastic OS=Calycanthus floridus var. glaucus GN=atpA PE=3 SV=1 1 229 7.0E-94
sp|A2C6X5|ATPA_PROM3 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9303) GN=atpA PE=3 SV=1 1 218 7.0E-94
sp|Q6YXK3|ATPA_PHYPA ATP synthase subunit alpha, chloroplastic OS=Physcomitrella patens subsp. patens GN=atpA PE=3 SV=1 1 229 7.0E-94
sp|Q8MA05|ATPA_CHAGL ATP synthase subunit alpha, chloroplastic OS=Chaetosphaeridium globosum GN=atpA PE=3 SV=1 1 230 8.0E-94
sp|Q6EW63|ATPA_NYMAL ATP synthase subunit alpha, chloroplastic OS=Nymphaea alba GN=atpA PE=3 SV=1 1 229 8.0E-94
sp|Q8KAW8|ATPA_CHLTE ATP synthase subunit alpha OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=atpA PE=3 SV=1 1 228 8.0E-94
sp|B4UKF2|ATPA_ANASK ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain K) GN=atpA PE=3 SV=1 1 212 9.0E-94
sp|Q32RS8|ATPA_STAPU ATP synthase subunit alpha, chloroplastic OS=Staurastrum punctulatum GN=atpA PE=3 SV=1 1 225 9.0E-94
sp|B8G6G8|ATPA_CHLAD ATP synthase subunit alpha OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=atpA PE=3 SV=1 1 228 1.0E-93
sp|A5G9D6|ATPA_GEOUR ATP synthase subunit alpha OS=Geobacter uraniireducens (strain Rf4) GN=atpA PE=3 SV=1 1 230 1.0E-93
sp|P12862|ATPAM_WHEAT ATP synthase subunit alpha, mitochondrial OS=Triticum aestivum GN=ATPA PE=3 SV=1 1 221 1.0E-93
sp|B2V6N6|ATPA_SULSY ATP synthase subunit alpha OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=atpA PE=3 SV=1 1 224 1.0E-93
sp|P18260|ATPAM_HELAN ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus GN=ATPA PE=3 SV=1 1 211 1.0E-93
sp|A4J9A1|ATPA_DESRM ATP synthase subunit alpha OS=Desulfotomaculum reducens (strain MI-1) GN=atpA PE=3 SV=1 1 228 1.0E-93
sp|B7K5I8|ATPA_CYAP8 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 8801) GN=atpA PE=3 SV=1 1 228 1.0E-93
sp|P45825|ATPA_MYCLE ATP synthase subunit alpha OS=Mycobacterium leprae (strain TN) GN=atpA PE=3 SV=1 1 228 2.0E-93
sp|B8ZR40|ATPA_MYCLB ATP synthase subunit alpha OS=Mycobacterium leprae (strain Br4923) GN=atpA PE=3 SV=1 1 228 2.0E-93
sp|Q1MRB9|ATPA_LAWIP ATP synthase subunit alpha OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpA PE=3 SV=1 1 229 2.0E-93
sp|Q7V5S7|ATPA_PROMM ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9313) GN=atpA PE=3 SV=1 1 218 2.0E-93
sp|C0Z778|ATPA_BREBN ATP synthase subunit alpha OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpA PE=3 SV=1 1 203 2.0E-93
sp|P51242|ATPA_PORPU ATP synthase subunit alpha, chloroplastic OS=Porphyra purpurea GN=atpA PE=3 SV=1 1 227 2.0E-93
sp|A8F3K0|ATPA_PSELT ATP synthase subunit alpha OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=atpA PE=3 SV=1 1 228 2.0E-93
sp|A1BJF5|ATPA_CHLPD ATP synthase subunit alpha OS=Chlorobium phaeobacteroides (strain DSM 266) GN=atpA PE=3 SV=1 1 228 2.0E-93
sp|Q5WB76|ATPA_BACSK ATP synthase subunit alpha OS=Bacillus clausii (strain KSM-K16) GN=atpA PE=3 SV=1 1 230 3.0E-93
sp|Q9TM26|ATPA_CYACA ATP synthase subunit alpha, chloroplastic OS=Cyanidium caldarium GN=atpA PE=3 SV=1 1 219 3.0E-93
sp|B3EHU6|ATPA_CHLL2 ATP synthase subunit alpha OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=atpA PE=3 SV=1 1 228 3.0E-93
sp|A0T0F1|ATPA_PHATC ATP synthase subunit alpha, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=atpA PE=3 SV=1 1 219 3.0E-93
sp|Q8S8Y3|ATPA_ATRBE ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna GN=atpA PE=3 SV=1 1 229 3.0E-93
sp|Q1XDP5|ATPA_PYRYE ATP synthase subunit alpha, chloroplastic OS=Pyropia yezoensis GN=atpA PE=3 SV=1 1 199 4.0E-93
sp|Q0G9N4|ATPA_LIRTU ATP synthase subunit alpha, chloroplastic OS=Liriodendron tulipifera GN=atpA PE=3 SV=1 1 229 4.0E-93
sp|P17674|ATPA_BACMQ ATP synthase subunit alpha OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpA PE=3 SV=1 1 227 4.0E-93
sp|Q6B8Q8|ATPA_GRATL ATP synthase subunit alpha, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=atpA PE=3 SV=1 1 203 6.0E-93
sp|Q70XV0|ATPA_AMBTC ATP synthase subunit alpha, chloroplastic OS=Amborella trichopoda GN=atpA PE=3 SV=1 1 229 6.0E-93
sp|Q8RGE0|ATPA_FUSNN ATP synthase subunit alpha OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpA PE=3 SV=1 1 228 7.0E-93
sp|Q3Z8Z4|ATPA_DEHM1 ATP synthase subunit alpha OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=atpA PE=3 SV=1 1 218 8.0E-93
sp|Q3ZZT9|ATPA_DEHMC ATP synthase subunit alpha OS=Dehalococcoides mccartyi (strain CBDB1) GN=atpA PE=3 SV=1 1 229 8.0E-93
sp|A5FRQ3|ATPA_DEHMB ATP synthase subunit alpha OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=atpA PE=3 SV=1 1 229 8.0E-93
sp|Q30QP9|ATPA_SULDN ATP synthase subunit alpha OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=atpA PE=3 SV=1 1 229 9.0E-93
sp|B2A3G4|ATPA_NATTJ ATP synthase subunit alpha OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=atpA PE=3 SV=1 1 220 1.0E-92
sp|Q46J57|ATPA_PROMT ATP synthase subunit alpha OS=Prochlorococcus marinus (strain NATL2A) GN=atpA PE=3 SV=1 1 230 1.0E-92
sp|Q06H12|ATPA_DRIGR ATP synthase subunit alpha, chloroplastic OS=Drimys granadensis GN=atpA PE=3 SV=1 1 229 1.0E-92
sp|Q71WP7|ATPA2_LISMF ATP synthase subunit alpha 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=atpA2 PE=3 SV=1 1 227 1.0E-92
sp|Q8Y4C0|ATPA2_LISMO ATP synthase subunit alpha 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=atpA2 PE=3 SV=1 1 227 1.0E-92
sp|Q927W2|ATPA2_LISIN ATP synthase subunit alpha 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=atpA2 PE=3 SV=1 1 227 1.0E-92
sp|Q85AU2|ATPA_ANTFO ATP synthase subunit alpha, chloroplastic OS=Anthoceros formosae GN=atpA PE=2 SV=1 1 229 1.0E-92
sp|A9WGS6|ATPA_CHLAA ATP synthase subunit alpha OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=atpA PE=3 SV=1 1 228 1.0E-92
sp|Q9BBS3|ATPA_LOTJA ATP synthase subunit alpha, chloroplastic OS=Lotus japonicus GN=atpA PE=3 SV=1 1 229 1.0E-92
sp|Q1B551|ATPA_MYCSS ATP synthase subunit alpha OS=Mycobacterium sp. (strain MCS) GN=atpA PE=3 SV=1 1 228 1.0E-92
sp|A1UJY6|ATPA_MYCSK ATP synthase subunit alpha OS=Mycobacterium sp. (strain KMS) GN=atpA PE=3 SV=1 1 228 1.0E-92
sp|A3Q3B3|ATPA_MYCSJ ATP synthase subunit alpha OS=Mycobacterium sp. (strain JLS) GN=atpA PE=3 SV=1 1 228 1.0E-92
sp|A7HJV9|ATPA_FERNB ATP synthase subunit alpha OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=atpA PE=3 SV=1 1 229 2.0E-92
sp|A4GGB2|ATPA_PHAVU ATP synthase subunit alpha, chloroplastic OS=Phaseolus vulgaris GN=atpA PE=3 SV=1 1 229 2.0E-92
sp|A0ALL5|ATPA2_LISW6 ATP synthase subunit alpha 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=atpA2 PE=3 SV=1 1 227 2.0E-92
sp|A6QB61|ATPA_SULNB ATP synthase subunit alpha OS=Sulfurovum sp. (strain NBC37-1) GN=atpA PE=3 SV=1 1 228 2.0E-92
sp|Q3ZJ00|ATPA_PSEAK ATP synthase subunit alpha, chloroplastic OS=Pseudendoclonium akinetum GN=atpA PE=3 SV=1 1 219 2.0E-92
sp|Q20EV9|ATPA_OLTVI ATP synthase subunit alpha, chloroplastic OS=Oltmannsiellopsis viridis GN=atpA PE=3 SV=1 1 219 2.0E-92
sp|P06450|ATPA_SPIOL ATP synthase subunit alpha, chloroplastic OS=Spinacia oleracea GN=atpA PE=1 SV=1 1 229 2.0E-92
sp|A0Q2Z6|ATPA_CLONN ATP synthase subunit alpha OS=Clostridium novyi (strain NT) GN=atpA PE=3 SV=1 1 230 2.0E-92
sp|C6E9F3|ATPA_GEOSM ATP synthase subunit alpha OS=Geobacter sp. (strain M21) GN=atpA PE=3 SV=1 1 228 2.0E-92
sp|A4QJI4|ATPA_AETGR ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum GN=atpA PE=3 SV=1 1 229 2.0E-92
sp|A6MMA7|ATPA_CHLSC ATP synthase subunit alpha, chloroplastic OS=Chloranthus spicatus GN=atpA PE=3 SV=1 1 229 2.0E-92
sp|B5EFI9|ATPA_GEOBB ATP synthase subunit alpha OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpA PE=3 SV=1 1 228 2.0E-92
sp|Q180W8|ATPA_PEPD6 ATP synthase subunit alpha OS=Peptoclostridium difficile (strain 630) GN=atpA PE=3 SV=1 1 199 2.0E-92
sp|Q02848|ATPA_ANTSP ATP synthase subunit alpha, chloroplastic OS=Antithamnion sp. GN=atpA PE=3 SV=1 1 203 2.0E-92
sp|A0LSL4|ATPA_ACIC1 ATP synthase subunit alpha OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=atpA PE=3 SV=1 1 228 3.0E-92
sp|Q8EM81|ATPA_OCEIH ATP synthase subunit alpha OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=atpA PE=3 SV=1 1 229 3.0E-92
sp|A0R202|ATPA_MYCS2 ATP synthase subunit alpha OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=atpA PE=1 SV=1 1 228 3.0E-92
sp|A1R7V5|ATPA_ARTAT ATP synthase subunit alpha OS=Arthrobacter aurescens (strain TC1) GN=atpA PE=3 SV=2 1 229 3.0E-92
sp|A1TD57|ATPA_MYCVP ATP synthase subunit alpha OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=atpA PE=3 SV=1 1 228 3.0E-92
sp|Q33C53|ATPA_NICTO ATP synthase subunit alpha, chloroplastic OS=Nicotiana tomentosiformis GN=atpA PE=3 SV=1 1 219 3.0E-92
sp|B1A920|ATPA_CARPA ATP synthase subunit alpha, chloroplastic OS=Carica papaya GN=atpA PE=3 SV=1 1 229 3.0E-92
sp|P55987|ATPA_HELPY ATP synthase subunit alpha OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=atpA PE=3 SV=1 1 224 3.0E-92
sp|B6JMX4|ATPA_HELP2 ATP synthase subunit alpha OS=Helicobacter pylori (strain P12) GN=atpA PE=3 SV=1 1 224 3.0E-92
sp|Q3C1H4|ATPA_NICSY ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris GN=atpA PE=3 SV=1 1 229 3.0E-92
sp|Q1CSD3|ATPA_HELPH ATP synthase subunit alpha OS=Helicobacter pylori (strain HPAG1) GN=atpA PE=3 SV=1 1 224 3.0E-92
sp|B5Z8D2|ATPA_HELPG ATP synthase subunit alpha OS=Helicobacter pylori (strain G27) GN=atpA PE=3 SV=1 1 224 3.0E-92
sp|B0JWV1|ATPA_MICAN ATP synthase subunit alpha OS=Microcystis aeruginosa (strain NIES-843) GN=atpA PE=3 SV=1 1 228 4.0E-92
sp|A1XFU0|ATPA_NUPAD ATP synthase subunit alpha, chloroplastic OS=Nuphar advena GN=atpA PE=3 SV=1 1 229 4.0E-92
sp|A9L981|ATPA_LEMMI ATP synthase subunit alpha, chloroplastic OS=Lemna minor GN=atpA PE=3 SV=1 1 229 4.0E-92
sp|Q8CNJ5|ATPA_STAES ATP synthase subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=atpA PE=3 SV=1 1 227 4.0E-92
sp|Q5HMB7|ATPA_STAEQ ATP synthase subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=atpA PE=3 SV=1 1 227 4.0E-92
sp|Q09X32|ATPA_MORIN ATP synthase subunit alpha, chloroplastic OS=Morus indica GN=atpA PE=3 SV=1 1 229 4.0E-92
sp|Q1KXW5|ATPA_HELAN ATP synthase subunit alpha, chloroplastic OS=Helianthus annuus GN=atpA PE=3 SV=1 1 219 6.0E-92
sp|A6H5F1|ATPA_CYCTA ATP synthase subunit alpha, chloroplastic OS=Cycas taitungensis GN=atpA PE=3 SV=1 1 229 6.0E-92
sp|Q47M80|ATPA_THEFY ATP synthase subunit alpha OS=Thermobifida fusca (strain YX) GN=atpA PE=3 SV=1 1 228 6.0E-92
sp|A1XGM3|ATPA_RANMC ATP synthase subunit alpha, chloroplastic OS=Ranunculus macranthus GN=atpA PE=3 SV=1 1 229 7.0E-92
sp|A7ZC35|ATPA_CAMC1 ATP synthase subunit alpha OS=Campylobacter concisus (strain 13826) GN=atpA PE=3 SV=1 1 228 7.0E-92
sp|Q0G9X7|ATPA_DAUCA ATP synthase subunit alpha, chloroplastic OS=Daucus carota GN=atpA PE=3 SV=1 1 229 8.0E-92
sp|P26679|ATPA_ENTHA ATP synthase subunit alpha OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=atpA PE=3 SV=1 1 203 8.0E-92
sp|A7H1H9|ATPA_CAMJD ATP synthase subunit alpha OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpA PE=3 SV=1 1 229 8.0E-92
sp|A9BCD9|ATPA_PROM4 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain MIT 9211) GN=atpA PE=3 SV=1 1 219 9.0E-92
sp|A4T8K0|ATPA_MYCGI ATP synthase subunit alpha OS=Mycobacterium gilvum (strain PYR-GCK) GN=atpA PE=3 SV=1 1 228 1.0E-91
sp|A4QJA0|ATPA_AETCO ATP synthase subunit alpha, chloroplastic OS=Aethionema cordifolium GN=atpA PE=3 SV=1 1 229 1.0E-91
sp|A9AVV2|ATPA_HERA2 ATP synthase subunit alpha OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=atpA PE=3 SV=1 1 224 1.0E-91
sp|Q00820|ATPA_ODOSI ATP synthase subunit alpha, chloroplastic OS=Odontella sinensis GN=atpA PE=3 SV=1 1 219 1.0E-91
sp|Q5HX61|ATPA_CAMJR ATP synthase subunit alpha OS=Campylobacter jejuni (strain RM1221) GN=atpA PE=3 SV=1 1 229 1.0E-91
sp|Q9PJ21|ATPA_CAMJE ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpA PE=3 SV=1 1 229 1.0E-91
sp|A8FJR0|ATPA_CAMJ8 ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpA PE=3 SV=1 1 229 1.0E-91
sp|Q9MUT2|ATPA_MESVI ATP synthase subunit alpha, chloroplastic OS=Mesostigma viride GN=atpA PE=3 SV=1 1 228 1.0E-91
sp|B2UUP2|ATPA_HELPS ATP synthase subunit alpha OS=Helicobacter pylori (strain Shi470) GN=atpA PE=3 SV=1 1 224 1.0E-91
sp|Q68S21|ATPA_PANGI ATP synthase subunit alpha, chloroplastic OS=Panax ginseng GN=atpA PE=3 SV=1 1 219 1.0E-91
sp|B2KEX0|ATPA_ELUMP ATP synthase subunit alpha OS=Elusimicrobium minutum (strain Pei191) GN=atpA PE=3 SV=1 1 228 1.0E-91
sp|B1NWD5|ATPA_MANES ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta GN=atpA PE=3 SV=1 1 219 2.0E-91
sp|A1VXI8|ATPA_CAMJJ ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpA PE=3 SV=1 1 229 2.0E-91
sp|Q6MGM5|ATPA_BDEBA ATP synthase subunit alpha OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpA PE=3 SV=1 1 217 2.0E-91
sp|B2UZJ8|ATPA_CLOBA ATP synthase subunit alpha OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpA PE=3 SV=1 1 229 2.0E-91
sp|P12405|ATPA_NOSS1 ATP synthase subunit alpha OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpA PE=3 SV=2 1 228 2.0E-91
sp|Q2PMS8|ATPA_SOYBN ATP synthase subunit alpha, chloroplastic OS=Glycine max GN=atpA PE=3 SV=1 1 229 2.0E-91
sp|A4QL04|ATPA_DRANE ATP synthase subunit alpha, chloroplastic OS=Draba nemorosa GN=atpA PE=3 SV=1 1 229 2.0E-91
sp|Q9K6H3|ATPA_BACHD ATP synthase subunit alpha OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=atpA PE=3 SV=1 1 227 2.0E-91
sp|Q332Y4|ATPA_LACSA ATP synthase subunit alpha, chloroplastic OS=Lactuca sativa GN=atpA PE=3 SV=1 1 219 2.0E-91
sp|A4QLR8|ATPA_NASOF ATP synthase subunit alpha, chloroplastic OS=Nasturtium officinale GN=atpA PE=3 SV=1 1 229 2.0E-91
sp|Q27S65|ATPA_SOLTU ATP synthase subunit alpha, chloroplastic OS=Solanum tuberosum GN=atpA PE=3 SV=1 1 229 3.0E-91
sp|Q2MIB5|ATPA_SOLLC ATP synthase subunit alpha, chloroplastic OS=Solanum lycopersicum GN=atpA PE=3 SV=1 1 229 3.0E-91
sp|Q2MIK2|ATPA_SOLBU ATP synthase subunit alpha, chloroplastic OS=Solanum bulbocastanum GN=atpA PE=3 SV=1 1 229 3.0E-91
sp|A4QK90|ATPA_BARVE ATP synthase subunit alpha, chloroplastic OS=Barbarea verna GN=atpA PE=3 SV=1 1 229 3.0E-91
sp|Q831A3|ATPA_ENTFA ATP synthase subunit alpha OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpA PE=3 SV=1 1 224 3.0E-91
sp|Q17Y80|ATPA_HELAH ATP synthase subunit alpha OS=Helicobacter acinonychis (strain Sheeba) GN=atpA PE=3 SV=1 1 224 3.0E-91
sp|Q32RL1|ATPA_ZYGCR ATP synthase subunit alpha, chloroplastic OS=Zygnema circumcarinatum GN=atpA PE=3 SV=1 1 229 3.0E-91
sp|Q7MA20|ATPA_WOLSU ATP synthase subunit alpha OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=atpA PE=3 SV=1 1 230 4.0E-91
sp|B2TJZ8|ATPA_CLOBB ATP synthase subunit alpha OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpA PE=3 SV=1 1 229 4.0E-91
sp|Q2GER5|ATPA_NEOSM ATP synthase subunit alpha OS=Neorickettsia sennetsu (strain Miyayama) GN=atpA PE=3 SV=1 1 211 4.0E-91
sp|P56757|ATPA_ARATH ATP synthase subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=atpA PE=1 SV=1 1 229 4.0E-91
sp|A8SE59|ATPA_CERDE ATP synthase subunit alpha, chloroplastic OS=Ceratophyllum demersum GN=atpA PE=3 SV=1 1 229 4.0E-91
sp|A2C4J5|ATPA_PROM1 ATP synthase subunit alpha OS=Prochlorococcus marinus (strain NATL1A) GN=atpA PE=3 SV=1 1 230 5.0E-91
sp|Q4L7Y6|ATPA_STAHJ ATP synthase subunit alpha OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpA PE=3 SV=1 1 227 5.0E-91
sp|A6LQH4|ATPA_CLOB8 ATP synthase subunit alpha OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=atpA PE=3 SV=1 1 229 5.0E-91
sp|A0T0P4|ATPA_THAPS ATP synthase subunit alpha, chloroplastic OS=Thalassiosira pseudonana GN=atpA PE=3 SV=1 1 196 5.0E-91
sp|A4QL91|ATPA_LEPVR ATP synthase subunit alpha, chloroplastic OS=Lepidium virginicum GN=atpA PE=3 SV=1 1 229 6.0E-91
sp|A6MMS9|ATPA_ILLOL ATP synthase subunit alpha, chloroplastic OS=Illicium oligandrum GN=atpA PE=3 SV=1 1 229 6.0E-91
sp|A7M951|ATPA_CUSRE ATP synthase subunit alpha, plastid OS=Cuscuta reflexa GN=atpA PE=3 SV=1 1 229 6.0E-91
sp|Q09G61|ATPA_PLAOC ATP synthase subunit alpha, chloroplastic OS=Platanus occidentalis GN=atpA PE=3 SV=1 1 229 7.0E-91
sp|A7H019|ATPA_CAMC5 ATP synthase subunit alpha OS=Campylobacter curvus (strain 525.92) GN=atpA PE=3 SV=1 1 203 7.0E-91
sp|Q3M9W0|ATPA_ANAVT ATP synthase subunit alpha OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpA PE=3 SV=2 1 228 7.0E-91
sp|Q09MJ3|ATPA_CITSI ATP synthase subunit alpha, chloroplastic OS=Citrus sinensis GN=atpA PE=3 SV=1 1 219 7.0E-91
sp|Q49L13|ATPA_EUCGG ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=atpA PE=3 SV=1 1 229 8.0E-91
sp|A4QK03|ATPA_ARAHI ATP synthase subunit alpha, chloroplastic OS=Arabis hirsuta GN=atpA PE=3 SV=1 1 229 8.0E-91
sp|P29706|ATPA_PROMO ATP synthase subunit alpha, sodium ion specific OS=Propionigenium modestum GN=atpA PE=1 SV=2 1 228 8.0E-91
sp|P06283|ATPA_MARPO ATP synthase subunit alpha, chloroplastic OS=Marchantia polymorpha GN=atpA PE=3 SV=1 1 229 8.0E-91
sp|A8EV72|ATPA_ARCB4 ATP synthase subunit alpha OS=Arcobacter butzleri (strain RM4018) GN=atpA PE=3 SV=1 1 228 8.0E-91
sp|Q3AUA7|ATPA_CHLCH ATP synthase subunit alpha OS=Chlorobium chlorochromatii (strain CaD3) GN=atpA PE=3 SV=1 1 228 8.0E-91
sp|A4QJR8|ATPA_OLIPU ATP synthase subunit alpha, chloroplastic OS=Olimarabidopsis pumila GN=atpA PE=3 SV=1 1 229 9.0E-91
sp|P00823|ATPA_TOBAC ATP synthase subunit alpha, chloroplastic OS=Nicotiana tabacum GN=atpA PE=2 SV=2 1 229 9.0E-91
sp|B4SGC7|ATPA_PELPB ATP synthase subunit alpha OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=atpA PE=3 SV=1 1 228 1.0E-90
sp|Q3V549|ATPA_ACOCL ATP synthase subunit alpha, chloroplastic OS=Acorus calamus GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|A9LYH0|ATPA_ACOAM ATP synthase subunit alpha, chloroplastic OS=Acorus americanus GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|Q09FX6|ATPA_NANDO ATP synthase subunit alpha, chloroplastic OS=Nandina domestica GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|B9E8E8|ATPA_MACCJ ATP synthase subunit alpha OS=Macrococcus caseolyticus (strain JCSC5402) GN=atpA PE=3 SV=1 1 203 1.0E-90
sp|Q9ZK79|ATPA_HELPJ ATP synthase subunit alpha OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=atpA PE=3 SV=1 1 224 1.0E-90
sp|A4QKR6|ATPA_CRUWA ATP synthase subunit alpha, chloroplastic OS=Crucihimalaya wallichii GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|A4QKH7|ATPA_CAPBU ATP synthase subunit alpha, chloroplastic OS=Capsella bursa-pastoris GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|Q8WI30|ATPA_PSINU ATP synthase subunit alpha, chloroplastic OS=Psilotum nudum GN=atpA PE=3 SV=1 1 199 1.0E-90
sp|A3DIM7|ATPA_CLOTH ATP synthase subunit alpha OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|A6MM21|ATPA_BUXMI ATP synthase subunit alpha, chloroplastic OS=Buxus microphylla GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|A4QLH9|ATPA_LOBMA ATP synthase subunit alpha, chloroplastic OS=Lobularia maritima GN=atpA PE=3 SV=1 1 229 1.0E-90
sp|P63676|ATPA_STAAW ATP synthase subunit alpha OS=Staphylococcus aureus (strain MW2) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|A8YY72|ATPA_STAAT ATP synthase subunit alpha OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|Q6G7K5|ATPA_STAAS ATP synthase subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|Q6GEX0|ATPA_STAAR ATP synthase subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|P99111|ATPA_STAAN ATP synthase subunit alpha OS=Staphylococcus aureus (strain N315) GN=atpA PE=1 SV=1 1 228 2.0E-90
sp|P63675|ATPA_STAAM ATP synthase subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|A5IUQ0|ATPA_STAA9 ATP synthase subunit alpha OS=Staphylococcus aureus (strain JH9) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|Q2FWE8|ATPA_STAA8 ATP synthase subunit alpha OS=Staphylococcus aureus (strain NCTC 8325) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|Q2FF22|ATPA_STAA3 ATP synthase subunit alpha OS=Staphylococcus aureus (strain USA300) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|A6U3J0|ATPA_STAA2 ATP synthase subunit alpha OS=Staphylococcus aureus (strain JH1) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|A7X4U5|ATPA_STAA1 ATP synthase subunit alpha OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|Q49Z52|ATPA_STAS1 ATP synthase subunit alpha OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=atpA PE=3 SV=1 1 227 2.0E-90
sp|Q2YUJ9|ATPA_STAAB ATP synthase subunit alpha OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpA PE=3 SV=1 1 228 2.0E-90
sp|Q2QDA3|ATPA_CUCSA ATP synthase subunit alpha, chloroplastic OS=Cucumis sativus GN=atpA PE=3 SV=1 1 229 2.0E-90
sp|A0JY66|ATPA_ARTS2 ATP synthase subunit alpha OS=Arthrobacter sp. (strain FB24) GN=atpA PE=3 SV=2 1 229 2.0E-90
sp|B1IE32|ATPA_CLOBK ATP synthase subunit alpha OS=Clostridium botulinum (strain Okra / Type B1) GN=atpA PE=3 SV=1 1 230 2.0E-90
sp|A7G9Q7|ATPA_CLOBL ATP synthase subunit alpha OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpA PE=3 SV=1 1 230 2.0E-90
sp|A5UQN5|ATPA_ROSS1 ATP synthase subunit alpha OS=Roseiflexus sp. (strain RS-1) GN=atpA PE=3 SV=1 1 199 2.0E-90
sp|Q0ZJ35|ATPA_VITVI ATP synthase subunit alpha, chloroplastic OS=Vitis vinifera GN=atpA PE=3 SV=1 1 229 3.0E-90
sp|P30392|ATPA_EUGGR ATP synthase subunit alpha, chloroplastic OS=Euglena gracilis GN=atpA PE=3 SV=1 1 205 3.0E-90
sp|C1FQP3|ATPA_CLOBJ ATP synthase subunit alpha OS=Clostridium botulinum (strain Kyoto / Type A2) GN=atpA PE=3 SV=1 1 230 3.0E-90
sp|A5HY50|ATPA_CLOBH ATP synthase subunit alpha OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpA PE=3 SV=1 1 230 3.0E-90
sp|C3KYJ1|ATPA_CLOB6 ATP synthase subunit alpha OS=Clostridium botulinum (strain 657 / Type Ba4) GN=atpA PE=3 SV=1 1 230 3.0E-90
sp|A7FQH7|ATPA_CLOB1 ATP synthase subunit alpha OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpA PE=3 SV=1 1 230 3.0E-90
sp|B8HAZ1|ATPA_ARTCA ATP synthase subunit alpha OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=atpA PE=3 SV=1 1 229 3.0E-90
sp|Q3B1F4|ATPA2_CHLL7 ATP synthase subunit alpha 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpA2 PE=3 SV=1 1 228 3.0E-90
sp|Q85FN4|ATPA_ADICA ATP synthase subunit alpha, chloroplastic OS=Adiantum capillus-veneris GN=atpA PE=2 SV=2 1 229 4.0E-90
sp|Q1KVU0|ATPA_ACUOB ATP synthase subunit alpha, chloroplastic OS=Acutodesmus obliquus GN=atpA PE=3 SV=1 1 228 4.0E-90
sp|B9KES1|ATPA_CAMLR ATP synthase subunit alpha OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=atpA PE=3 SV=1 1 224 5.0E-90
sp|A0A320|ATPA_COFAR ATP synthase subunit alpha, chloroplastic OS=Coffea arabica GN=atpA PE=3 SV=1 1 229 5.0E-90
sp|Q0SQZ3|ATPA_CLOPS ATP synthase subunit alpha OS=Clostridium perfringens (strain SM101 / Type A) GN=atpA PE=3 SV=1 1 229 7.0E-90
sp|B3CN53|ATPA_WOLPP ATP synthase subunit alpha OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpA PE=3 SV=1 1 228 7.0E-90
sp|C1F3N8|ATPA_ACIC5 ATP synthase subunit alpha OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=atpA PE=3 SV=1 1 230 8.0E-90
sp|Q06RE6|ATPA_JASNU ATP synthase subunit alpha, chloroplastic OS=Jasminum nudiflorum GN=atpA PE=3 SV=1 1 229 8.0E-90
sp|A7NIR1|ATPA_ROSCS ATP synthase subunit alpha OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=atpA PE=3 SV=1 1 199 8.0E-90
sp|A6QIU9|ATPA_STAAE ATP synthase subunit alpha OS=Staphylococcus aureus (strain Newman) GN=atpA PE=3 SV=1 1 228 8.0E-90
sp|Q5HE95|ATPA_STAAC ATP synthase subunit alpha OS=Staphylococcus aureus (strain COL) GN=atpA PE=3 SV=1 1 228 8.0E-90
sp|A6MMJ2|ATPA_DIOEL ATP synthase subunit alpha, chloroplastic OS=Dioscorea elephantipes GN=atpA PE=3 SV=1 1 229 8.0E-90
sp|Q8XID2|ATPA_CLOPE ATP synthase subunit alpha OS=Clostridium perfringens (strain 13 / Type A) GN=atpA PE=3 SV=1 1 229 9.0E-90
sp|Q0TNC2|ATPA_CLOP1 ATP synthase subunit alpha OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpA PE=3 SV=1 1 229 9.0E-90
sp|P48080|ATPA_CYAPA ATP synthase subunit alpha, cyanelle OS=Cyanophora paradoxa GN=atpA PE=3 SV=1 1 230 9.0E-90
sp|Q31DL8|ATPA_THICR ATP synthase subunit alpha OS=Thiomicrospira crunogena (strain XCL-2) GN=atpA PE=3 SV=1 1 224 1.0E-89
sp|Q11YP1|ATPA_CYTH3 ATP synthase subunit alpha OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpA PE=3 SV=1 1 220 1.0E-89
sp|Q2S432|ATPA_SALRD ATP synthase subunit alpha OS=Salinibacter ruber (strain DSM 13855 / M31) GN=atpA PE=3 SV=1 1 220 1.0E-89
sp|Q06FX6|ATPA_PELHO ATP synthase subunit alpha, chloroplastic OS=Pelargonium hortorum GN=atpA PE=3 SV=1 1 219 1.0E-89
sp|A7Y3A4|ATPA_IPOPU ATP synthase subunit alpha, chloroplastic OS=Ipomoea purpurea GN=atpA PE=3 SV=1 1 229 1.0E-89
sp|Q3AHK5|ATPA_SYNSC ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9605) GN=atpA PE=3 SV=1 1 230 1.0E-89
sp|A8W3A9|ATPA_CUSEX ATP synthase subunit alpha, plastid OS=Cuscuta exaltata GN=atpA PE=3 SV=1 1 219 1.0E-89
sp|Q02BU3|ATPA_SOLUE ATP synthase subunit alpha OS=Solibacter usitatus (strain Ellin6076) GN=atpA PE=3 SV=1 1 230 2.0E-89
sp|C4KYS5|ATPA_EXISA ATP synthase subunit alpha OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpA PE=3 SV=1 1 207 2.0E-89
sp|Q589B3|ATPA_SILLA ATP synthase subunit alpha, chloroplastic OS=Silene latifolia GN=atpA PE=3 SV=1 1 229 2.0E-89
sp|P22477|ATPA_BACPE ATP synthase subunit alpha OS=Bacillus pseudofirmus (strain OF4) GN=atpA PE=3 SV=2 1 228 2.0E-89
sp|A7M8Y9|ATPA_CUSGR ATP synthase subunit alpha, plastid OS=Cuscuta gronovii GN=atpA PE=3 SV=1 1 229 2.0E-89
sp|B1KSS6|ATPA_CLOBM ATP synthase subunit alpha OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpA PE=3 SV=1 1 230 2.0E-89
sp|P08215|ATPA_PEA ATP synthase subunit alpha, chloroplastic OS=Pisum sativum GN=atpA PE=3 SV=1 1 219 2.0E-89
sp|C1D5G4|ATPA_LARHH ATP synthase subunit alpha OS=Laribacter hongkongensis (strain HLHK9) GN=atpA PE=3 SV=1 1 224 2.0E-89
sp|C0R2Y2|ATPA_WOLWR ATP synthase subunit alpha OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpA PE=3 SV=1 1 228 3.0E-89
sp|A8W3H5|ATPA_CUSOB ATP synthase subunit alpha, plastid OS=Cuscuta obtusiflora GN=atpA PE=3 SV=1 1 229 3.0E-89
sp|Q85FQ8|ATPA_CYAME ATP synthase subunit alpha, chloroplastic OS=Cyanidioschyzon merolae GN=atpA PE=3 SV=1 1 197 3.0E-89
sp|B2Y1W2|ATPA_WELMI ATP synthase subunit alpha, chloroplastic OS=Welwitschia mirabilis GN=atpA PE=3 SV=1 1 199 3.0E-89
sp|Q73HB2|ATPA_WOLPM ATP synthase subunit alpha OS=Wolbachia pipientis wMel GN=atpA PE=3 SV=1 1 206 3.0E-89
sp|C1AW01|ATPA_RHOOB ATP synthase subunit alpha OS=Rhodococcus opacus (strain B4) GN=atpA PE=3 SV=1 1 230 3.0E-89
sp|A9KK94|ATPA_CLOPH ATP synthase subunit alpha OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=atpA PE=3 SV=1 1 228 3.0E-89
sp|Q19VA5|ATPA_CHLAT ATP synthase subunit alpha, chloroplastic OS=Chlorokybus atmophyticus GN=atpA PE=3 SV=2 1 228 3.0E-89
sp|Q04ZU3|ATPA_LEPBL ATP synthase subunit alpha OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=atpA PE=3 SV=1 1 229 3.0E-89
sp|Q04S16|ATPA_LEPBJ ATP synthase subunit alpha OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=atpA PE=3 SV=1 1 229 3.0E-89
sp|A5EXJ7|ATPA_DICNV ATP synthase subunit alpha OS=Dichelobacter nodosus (strain VCS1703A) GN=atpA PE=3 SV=1 1 226 4.0E-89
sp|Q85X67|ATPA_PINKO ATP synthase subunit alpha, chloroplastic OS=Pinus koraiensis GN=atpA PE=3 SV=1 1 219 6.0E-89
sp|Q2L8Z1|ATPA_GOSHI ATP synthase subunit alpha, chloroplastic OS=Gossypium hirsutum GN=atpA PE=3 SV=1 1 219 7.0E-89
sp|Q0SGP7|ATPA_RHOJR ATP synthase subunit alpha OS=Rhodococcus jostii (strain RHA1) GN=atpA PE=3 SV=1 1 230 8.0E-89
sp|A9WNC6|ATPA_RENSM ATP synthase subunit alpha OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=atpA PE=3 SV=1 1 229 8.0E-89
sp|P50001|ATPA_STRLI ATP synthase subunit alpha OS=Streptomyces lividans GN=atpA PE=1 SV=2 1 228 1.0E-88
sp|Q9K4D5|ATPA_STRCO ATP synthase subunit alpha OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=atpA PE=3 SV=1 1 228 1.0E-88
sp|B1W0A5|ATPA_STRGG ATP synthase subunit alpha OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=atpA PE=3 SV=1 1 228 1.0E-88
sp|Q5KUJ1|ATPA_GEOKA ATP synthase subunit alpha OS=Geobacillus kaustophilus (strain HTA426) GN=atpA PE=1 SV=1 1 229 1.0E-88
sp|P09219|ATPA_BACP3 ATP synthase subunit alpha OS=Bacillus sp. (strain PS3) GN=atpA PE=1 SV=1 1 229 1.0E-88
sp|C5D992|ATPA_GEOSW ATP synthase subunit alpha OS=Geobacillus sp. (strain WCH70) GN=atpA PE=3 SV=1 1 203 1.0E-88
sp|A0ZZ20|ATPA_GOSBA ATP synthase subunit alpha, chloroplastic OS=Gossypium barbadense GN=atpA PE=3 SV=1 1 219 1.0E-88
sp|A4GYP3|ATPA_POPTR ATP synthase subunit alpha, chloroplastic OS=Populus trichocarpa GN=atpA PE=3 SV=1 1 229 1.0E-88
sp|Q14FH2|ATPA_POPAL ATP synthase subunit alpha, chloroplastic OS=Populus alba GN=atpA PE=3 SV=1 1 229 1.0E-88
sp|O99015|ATPA_PROWI ATP synthase subunit alpha, plastid OS=Prototheca wickerhamii GN=atpA PE=3 SV=1 1 229 2.0E-88
sp|Q1QSC8|ATPA_CHRSD ATP synthase subunit alpha OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpA PE=3 SV=1 1 218 2.0E-88
sp|P50000|ATPA_ACEWD ATP synthase subunit alpha, sodium ion specific OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655) GN=atpA PE=3 SV=3 1 228 2.0E-88
sp|A7Z9Q2|ATPA_BACMF ATP synthase subunit alpha OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpA PE=3 SV=1 1 207 2.0E-88
sp|B3QWX7|ATPA_CHLT3 ATP synthase subunit alpha OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpA PE=3 SV=1 1 228 2.0E-88
sp|Q88UU1|ATPA_LACPL ATP synthase subunit alpha OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=atpA PE=3 SV=1 1 203 2.0E-88
sp|A7I175|ATPA_CAMHC ATP synthase subunit alpha OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpA PE=3 SV=1 1 209 2.0E-88
sp|Q65DX2|ATPA_BACLD ATP synthase subunit alpha OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpA PE=3 SV=1 1 215 3.0E-88
sp|B0Z5D4|ATPA_OENPA ATP synthase subunit alpha, chloroplastic OS=Oenothera parviflora GN=atpA PE=3 SV=1 1 219 3.0E-88
sp|B0Z4N2|ATPA_OENAR ATP synthase subunit alpha, chloroplastic OS=Oenothera argillicola GN=atpA PE=3 SV=1 1 219 3.0E-88
sp|Q9MTL7|ATPA_OENEH ATP synthase subunit alpha, chloroplastic OS=Oenothera elata subsp. hookeri GN=atpA PE=3 SV=2 1 219 4.0E-88
sp|B3EL39|ATPA_CHLPB ATP synthase subunit alpha OS=Chlorobium phaeobacteroides (strain BS1) GN=atpA PE=3 SV=1 1 228 4.0E-88
sp|B0Z550|ATPA_OENGL ATP synthase subunit alpha, chloroplastic OS=Oenothera glazioviana GN=atpA PE=3 SV=1 1 219 4.0E-88
sp|Q5GSX1|ATPA_WOLTR ATP synthase subunit alpha OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpA PE=3 SV=1 1 228 4.0E-88
sp|B0Z4W6|ATPA_OENBI ATP synthase subunit alpha, chloroplastic OS=Oenothera biennis GN=atpA PE=3 SV=1 1 219 4.0E-88
sp|Q6L3A1|ATPA_SACHY ATP synthase subunit alpha, chloroplastic OS=Saccharum hybrid GN=atpA PE=2 SV=2 1 228 5.0E-88
sp|P37808|ATPA_BACSU ATP synthase subunit alpha OS=Bacillus subtilis (strain 168) GN=atpA PE=1 SV=3 1 207 6.0E-88
sp|Q3J6M9|ATPA_NITOC ATP synthase subunit alpha OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpA PE=3 SV=1 1 224 6.0E-88
sp|A2T317|ATPA_ANGEV ATP synthase subunit alpha, chloroplastic OS=Angiopteris evecta GN=atpA PE=3 SV=1 1 229 6.0E-88
sp|A5WBV9|ATPA_PSYWF ATP synthase subunit alpha OS=Psychrobacter sp. (strain PRwf-1) GN=atpA PE=3 SV=1 1 227 7.0E-88
sp|A6YG64|ATPA_LEPTE ATP synthase subunit alpha, chloroplastic OS=Leptosira terrestris GN=atpA PE=3 SV=1 1 229 7.0E-88
sp|A4XAW4|ATPA_SALTO ATP synthase subunit alpha OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=atpA PE=3 SV=1 1 229 8.0E-88
sp|A1U7H6|ATPA_MARHV ATP synthase subunit alpha OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=atpA PE=3 SV=1 1 224 9.0E-88
sp|A4ITJ1|ATPA_GEOTN ATP synthase subunit alpha OS=Geobacillus thermodenitrificans (strain NG80-2) GN=atpA PE=3 SV=1 1 203 9.0E-88
sp|Q38WK3|ATPA_LACSS ATP synthase subunit alpha OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=atpA PE=3 SV=1 1 229 9.0E-88
sp|Q3BAQ7|ATPA_PHAAO ATP synthase subunit alpha, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=atpA PE=3 SV=1 1 229 1.0E-87
sp|B2GAU3|ATPA_LACF3 ATP synthase subunit alpha OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=atpA PE=3 SV=1 1 228 1.0E-87
sp|A2RMI4|ATPA_LACLM ATP synthase subunit alpha OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=atpA PE=3 SV=1 1 224 1.0E-87
sp|Q06J68|ATPA_BIGNA ATP synthase subunit alpha, chloroplastic OS=Bigelowiella natans GN=atpA PE=3 SV=1 1 199 1.0E-87
sp|B1VFY5|ATPA_CORU7 ATP synthase subunit alpha OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=atpA PE=3 SV=1 1 228 1.0E-87
sp|Q9Z689|ATPA_CLOAB ATP synthase subunit alpha OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=atpA PE=3 SV=1 1 230 1.0E-87
sp|Q8RC17|ATPA_CALS4 ATP synthase subunit alpha OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=atpA PE=3 SV=1 1 218 1.0E-87
sp|A8M2J5|ATPA_SALAI ATP synthase subunit alpha OS=Salinispora arenicola (strain CNS-205) GN=atpA PE=3 SV=1 1 229 1.0E-87
sp|Q0P3K5|ATPA_OSTTA ATP synthase subunit alpha, chloroplastic OS=Ostreococcus tauri GN=atpA PE=3 SV=1 1 203 2.0E-87
sp|A7GV58|ATPA_BACCN ATP synthase subunit alpha OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpA PE=3 SV=1 1 227 2.0E-87
sp|Q6AG60|ATPA_LEIXX ATP synthase subunit alpha OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=atpA PE=3 SV=1 1 228 2.0E-87
sp|Q2J6N1|ATPA_FRASC ATP synthase subunit alpha OS=Frankia sp. (strain CcI3) GN=atpA PE=3 SV=1 1 228 2.0E-87
sp|A1E9S1|ATPA_SORBI ATP synthase subunit alpha, chloroplastic OS=Sorghum bicolor GN=atpA PE=3 SV=1 1 228 2.0E-87
sp|Q6ENW6|ATPA_SACOF ATP synthase subunit alpha, chloroplastic OS=Saccharum officinarum GN=atpA PE=3 SV=1 1 228 2.0E-87
sp|B3WDL6|ATPA_LACCB ATP synthase subunit alpha OS=Lactobacillus casei (strain BL23) GN=atpA PE=3 SV=1 1 228 2.0E-87
sp|Q03A20|ATPA_LACC3 ATP synthase subunit alpha OS=Lactobacillus casei (strain ATCC 334) GN=atpA PE=3 SV=1 1 228 2.0E-87
sp|A9VSA5|ATPA_BACWK ATP synthase subunit alpha OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpA PE=3 SV=1 1 227 2.0E-87
[Show less]

GO

GO Term Description Terminal node
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:0005524 ATP binding Yes
GO:0018130 heterocycle biosynthetic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901265 nucleoside phosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0043168 anion binding No
GO:0019693 ribose phosphate metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0044281 small molecule metabolic process No
GO:0032553 ribonucleotide binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006754 ATP biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0046390 ribose phosphate biosynthetic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0046034 ATP metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0005488 binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0009165 nucleotide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11825
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7321 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7321
MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKHGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLEQE
LFFKGVRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFSQFGSDLDASTKQTLSRGERLTELLKQ
KQYSPMAVNEMVPLIYAGVNGYLDPIPVDKVLQWEADYLAHLRSNEPELLATIDKEGAISDATGAKLKEITPAFI
KSFLS*
Coding >OphauG2|7321
ATGAGTCTTTTGTTGAGACGTCCTCCGGGTCGTGAGGCGTACCCCGGTGATGTTTTCTACCTTCACTCGCGTCTT
TTGGAACGTGCCGCCAAACTCAACGACAAGCATGGTGGTGGCTCACTCACTGCGTTGCCAATCATCGAGACACAA
GGAGGAGACGTATCGGCATATATTCCGACAAATGTCATTTCGATTACGGACGGGCAAATCTTCCTTGAGCAGGAG
CTCTTCTTCAAGGGTGTTCGGCCGGCCATCAACGTCGGTCTTTCGGTCTCTCGCGTCGGTTCTGCTGCACAGCTC
AAGGCCATGAAGCAAGTTGCTGGTTCTCTCAAGCTCTTCTTGGCGCAGTACCGTGAAGTGGCTGCCTTTTCTCAG
TTTGGCTCTGATCTTGATGCCTCTACCAAGCAGACTCTGTCCCGTGGCGAACGTTTGACTGAACTTCTCAAACAA
AAGCAGTACTCGCCCATGGCTGTTAATGAAATGGTTCCTCTCATTTATGCTGGTGTCAATGGCTATTTGGACCCG
ATTCCCGTCGACAAGGTGCTGCAGTGGGAGGCGGACTACCTGGCGCATCTCAGGTCTAACGAGCCGGAGCTGTTG
GCCACGATTGACAAGGAGGGCGCCATCAGCGACGCGACGGGAGCCAAGCTCAAGGAGATTACGCCCGCCTTTATC
AAGAGCTTCCTCAGCTAA
Transcript >OphauG2|7321
ATGAGTCTTTTGTTGAGACGTCCTCCGGGTCGTGAGGCGTACCCCGGTGATGTTTTCTACCTTCACTCGCGTCTT
TTGGAACGTGCCGCCAAACTCAACGACAAGCATGGTGGTGGCTCACTCACTGCGTTGCCAATCATCGAGACACAA
GGAGGAGACGTATCGGCATATATTCCGACAAATGTCATTTCGATTACGGACGGGCAAATCTTCCTTGAGCAGGAG
CTCTTCTTCAAGGGTGTTCGGCCGGCCATCAACGTCGGTCTTTCGGTCTCTCGCGTCGGTTCTGCTGCACAGCTC
AAGGCCATGAAGCAAGTTGCTGGTTCTCTCAAGCTCTTCTTGGCGCAGTACCGTGAAGTGGCTGCCTTTTCTCAG
TTTGGCTCTGATCTTGATGCCTCTACCAAGCAGACTCTGTCCCGTGGCGAACGTTTGACTGAACTTCTCAAACAA
AAGCAGTACTCGCCCATGGCTGTTAATGAAATGGTTCCTCTCATTTATGCTGGTGTCAATGGCTATTTGGACCCG
ATTCCCGTCGACAAGGTGCTGCAGTGGGAGGCGGACTACCTGGCGCATCTCAGGTCTAACGAGCCGGAGCTGTTG
GCCACGATTGACAAGGAGGGCGCCATCAGCGACGCGACGGGAGCCAAGCTCAAGGAGATTACGCCCGCCTTTATC
AAGAGCTTCCTCAGCTAA
Gene >OphauG2|7321
ATGAGTCTTTTGTTGAGACGTCCTCCGGGTCGTGAGGCGTACCCCGGTGATGTTTTCTACCTTCACTCGCGTCTT
TTGGAACGTGCCGCCAAACTCAACGACAAGCATGGTGGTGGCTCACTCACTGCGTTGCCAATCATCGAGACACAA
GGAGGAGACGTATCGGCATATATTCCGACAAATGTCATTTCGATTACGGACGGGCAAATCTTCCTTGAGCAGGAG
CTCTTCTTCAAGGGTGTTCGGCCGGCCATCAACGTCGGTCTTTCGGTCTCTCGCGTCGGTTCTGCTGCACAGCTC
AAGGCCATGAAGCAAGTTGCTGGTTCTCTCAAGCTCTTCTTGGCGCAGTACCGTGAAGTGGCTGCCTTTTCTCAG
TTTGGCTCTGATCTTGATGCCTCTACCAAGCAGACTCTGTCCCGTGGCGAACGTGTAAGCTGGATTTGCTGGTTT
CAGGCGTGTAACATGGGGACTTGCTAACTCGTTGACAGTTGACTGAACTTCTCAAACAAAAGCAGTACTCGCCCA
TGGCTGTTAATGAAATGGTTCCTCTCATTTATGCTGGTGTCAATGGCTATTTGGACCCGATTCCCGTCGACAAGG
TGCTGCAGTGGGAGGCGGACTACCTGGCGCATCTCAGGTCTAACGAGCCGGAGCTGTTGGCCACGATTGACAAGG
AGGGCGCCATCAGCGACGCGACGGGAGCCAAGCTCAAGGAGATTACGCCCGCCTTTATCAAGAGCTTCCTCAGCT
AA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail