Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|731
Gene name
LocationContig_119:7157..8117
Strand-
Gene length (bp)960
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12311 DUF3632 Protein of unknown function (DUF3632) 1.5E-34 74 253

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|731 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|732
Ophiocordyceps australis map64 (Brazil) OphauB2|450
Ophiocordyceps australis map64 (Brazil) OphauB2|451
Ophiocordyceps camponoti-floridani Ophcf2|01245
Ophiocordyceps camponoti-rufipedis Ophun1|3246
Ophiocordyceps kimflemingae Ophio5|2206
Ophiocordyceps kimflemingae Ophio5|2207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|731
MSSPPNITLTSTNSSTSSPTEPQLINILSAALNSTSSCSSPQPAADKAASQVDQLYPGSSSSADAIEAFLWSFWS
LLIAAAKKISATDNTRQNLLVDIVAKLKTCRDEHVELWGQQTRVWGELPMLGPCMREAWNLRPDFNSTSDDAIAE
WISLNSFAARLLAADLQSWVNFAIWELRASLEEEPPWTTKARDAGLAASCEWIRHAGLTLYRQGREAHELDAVEQ
RALKPGRLLHCGASGLSDMRWSFWKERLGLLGAGAGSGELKQRTQETIHGMKELEDKSS*
Coding >OphauG2|731
ATGTCTTCACCCCCAAACATTACCCTCACGTCAACCAACTCGTCGACCTCGTCCCCCACCGAACCCCAGCTCATC
AACATTCTATCCGCCGCTCTCAACAGCACATCGTCTTGCTCGTCGCCTCAACCCGCCGCCGACAAGGCTGCATCC
CAGGTTGACCAGCTTTACCCCGGCTCCTCGTCTAGTGCCGATGCGATTGAGGCTTTTCTATGGTCTTTTTGGTCC
CTGCTCATTGCCGCAGCCAAGAAGATCTCAGCCACCGACAATACGCGCCAGAATTTGCTAGTGGACATTGTTGCC
AAGCTCAAGACATGTCGGGACGAACACGTCGAGCTTTGGGGACAGCAGACGCGCGTTTGGGGAGAGCTGCCCATG
CTCGGTCCCTGTATGCGTGAAGCATGGAATCTGCGACCCGACTTCAACTCGACCAGTGACGACGCCATCGCTGAA
TGGATTTCACTCAACTCGTTCGCCGCCCGCCTTCTTGCTGCCGACCTGCAGTCGTGGGTTAATTTTGCCATCTGG
GAGCTGCGCGCCAGCCTGGAAGAGGAGCCCCCTTGGACCACCAAGGCTCGCGACGCCGGCCTCGCCGCCTCATGC
GAATGGATTCGTCACGCAGGGCTCACACTATACCGTCAAGGCCGCGAGGCACATGAGTTAGACGCCGTCGAGCAG
CGGGCCCTCAAGCCTGGACGCCTACTTCATTGTGGCGCTTCGGGGCTCAGCGACATGCGGTGGAGCTTTTGGAAA
GAGAGGCTTGGCCTGCTCGGAGCAGGAGCGGGGAGCGGAGAGCTGAAACAGAGAACCCAAGAAACAATACATGGA
ATGAAGGAGCTAGAAGACAAGTCGTCGTAG
Transcript >OphauG2|731
ATGTCTTCACCCCCAAACATTACCCTCACGTCAACCAACTCGTCGACCTCGTCCCCCACCGAACCCCAGCTCATC
AACATTCTATCCGCCGCTCTCAACAGCACATCGTCTTGCTCGTCGCCTCAACCCGCCGCCGACAAGGCTGCATCC
CAGGTTGACCAGCTTTACCCCGGCTCCTCGTCTAGTGCCGATGCGATTGAGGCTTTTCTATGGTCTTTTTGGTCC
CTGCTCATTGCCGCAGCCAAGAAGATCTCAGCCACCGACAATACGCGCCAGAATTTGCTAGTGGACATTGTTGCC
AAGCTCAAGACATGTCGGGACGAACACGTCGAGCTTTGGGGACAGCAGACGCGCGTTTGGGGAGAGCTGCCCATG
CTCGGTCCCTGTATGCGTGAAGCATGGAATCTGCGACCCGACTTCAACTCGACCAGTGACGACGCCATCGCTGAA
TGGATTTCACTCAACTCGTTCGCCGCCCGCCTTCTTGCTGCCGACCTGCAGTCGTGGGTTAATTTTGCCATCTGG
GAGCTGCGCGCCAGCCTGGAAGAGGAGCCCCCTTGGACCACCAAGGCTCGCGACGCCGGCCTCGCCGCCTCATGC
GAATGGATTCGTCACGCAGGGCTCACACTATACCGTCAAGGCCGCGAGGCACATGAGTTAGACGCCGTCGAGCAG
CGGGCCCTCAAGCCTGGACGCCTACTTCATTGTGGCGCTTCGGGGCTCAGCGACATGCGGTGGAGCTTTTGGAAA
GAGAGGCTTGGCCTGCTCGGAGCAGGAGCGGGGAGCGGAGAGCTGAAACAGAGAACCCAAGAAACAATACATGGA
ATGAAGGAGCTAGAAGACAAGTCGTCGTAG
Gene >OphauG2|731
ATGTCTTCACCCCCAAACATTACCCTCACGTCAACCAACTCGTCGACCTCGTCCCCCACCGAACCCCAGCTCATC
AACATTCTATCCGCCGCTCTCAACAGCACATCGTCTTGCTCGTCGCCTCAACCCGCCGCCGACAAGGCTGCATCC
CAGGTTGACCAGCTTTACCCCGGCTCCTCGTCTAGTGCCGATGCGATTGAGGCTTTTCTATGGTCTTTTTGGTCC
CTGCTCATTGCCGCAGCCAAGAAGATCTCAGCCACCGACAATACGCGCCAGAATTTGCTAGTGGACATTGTTGCC
AAGCTCAAGACATGTCGGGACGAACACGTCGAGCTTTGGGGACAGCAGACGCGCGTTTGGGGAGAGCTGCCCATG
CTCGGTCCCTGTATGCGTGAAGCATGGAATCGTACGTGTCTCAGATTTCTTGCATGATTTGCTTCAAACCGTTTT
CCAAAAAATGTCTTGATTTTTAATTTTCTCTTCACCAAGACTTACATACTTGCTGTTGTAGTGCGACCCGACTTC
AACTCGACCAGTGACGACGCCATCGCTGAATGGATTTCACTCAACTCGTTCGCCGCCCGCCTTCTTGCTGCCGAC
CTGCAGTCGTGGGTTAATTTTGCCATCTGGGAGCTGCGCGCCAGCCTGGAAGAGGAGCCCCCTTGGACCACCAAG
GCTCGCGACGCCGGCCTCGCCGCCTCATGCGAATGGATTCGTCACGCAGGGCTCACACTATACCGTCAAGGCCGC
GAGGCACATGAGTTAGACGCCGTCGAGCAGCGGGCCCTCAAGCCTGGACGCCTACTTCATTGTGGCGCTTCGGGG
CTCAGCGACATGCGGTGGAGCTTTTGGAAAGAGAGGCTTGGCCTGCTCGGAGCAGGAGCGGGGAGCGGAGAGCTG
AAACAGAGAACCCAAGAAACAATACATGGAATGAAGGAGCTAGAAGACAAGTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail