Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7308
Gene name
LocationContig_837:4035..4650
Strand+
Gene length (bp)615
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12689 Acid_PPase Acid Phosphatase 2.9E-62 28 196

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94279|MGDP1_SCHPO Putative magnesium-dependent phosphatase P8B7.31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.31 PE=1 SV=2 27 175 4.0E-38
sp|Q9D967|MGDP1_MOUSE Magnesium-dependent phosphatase 1 OS=Mus musculus GN=Mdp1 PE=1 SV=1 29 194 2.0E-35
sp|Q86V88|MGDP1_HUMAN Magnesium-dependent phosphatase 1 OS=Homo sapiens GN=MDP1 PE=1 SV=1 29 194 6.0E-32
sp|P40081|MGDP1_YEAST Putative magnesium-dependent phosphatase YER134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER134C PE=1 SV=1 30 184 5.0E-20

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7308
MPRKASKQAPSSSTPTPIPDSLSDPCLPLPDLIVFDLDYTLWPFWVDTHVTPPLRSNAAHSVAADAKGETFAFYH
DVPAILHFLARRNIKLAVASRTSAPSVARDLLCLLYLPADESDKRKKAINVFDAGLEIYPSSKLRHFEALHKRTG
LVYQDVLFFDDESRNRETEQLGVTMRLVRDGMTWHELVKGIEEWRSRRETRSER*
Coding >OphauG2|7308
ATGCCCCGCAAAGCCTCCAAACAAGCCCCCTCGTCCTCGACACCCACTCCCATCCCCGACTCCTTGTCCGACCCG
TGCCTCCCTCTTCCCGACCTCATCGTCTTTGACCTCGACTACACCCTCTGGCCCTTTTGGGTCGACACACACGTC
ACTCCTCCTCTCCGCTCCAACGCCGCCCATTCTGTAGCCGCCGACGCAAAGGGCGAGACTTTTGCCTTTTATCAC
GACGTGCCCGCCATTCTTCACTTCCTCGCCCGTCGCAACATCAAGTTGGCCGTTGCCTCACGCACAAGTGCCCCT
AGTGTCGCCCGCGACTTGCTTTGCTTGCTCTACTTGCCCGCCGACGAGTCGGATAAGAGGAAAAAGGCAATCAAT
GTTTTTGACGCTGGCCTCGAGATTTATCCCAGTAGTAAACTGCGCCATTTCGAAGCCCTGCATAAGCGTACCGGC
CTTGTCTATCAGGATGTTCTCTTTTTCGATGACGAGAGCCGCAATCGCGAGACGGAGCAGTTGGGCGTCACCATG
CGCCTGGTGCGCGACGGCATGACGTGGCATGAGCTTGTCAAGGGCATAGAAGAGTGGCGGTCAAGACGAGAAACA
AGATCAGAAAGGTAA
Transcript >OphauG2|7308
ATGCCCCGCAAAGCCTCCAAACAAGCCCCCTCGTCCTCGACACCCACTCCCATCCCCGACTCCTTGTCCGACCCG
TGCCTCCCTCTTCCCGACCTCATCGTCTTTGACCTCGACTACACCCTCTGGCCCTTTTGGGTCGACACACACGTC
ACTCCTCCTCTCCGCTCCAACGCCGCCCATTCTGTAGCCGCCGACGCAAAGGGCGAGACTTTTGCCTTTTATCAC
GACGTGCCCGCCATTCTTCACTTCCTCGCCCGTCGCAACATCAAGTTGGCCGTTGCCTCACGCACAAGTGCCCCT
AGTGTCGCCCGCGACTTGCTTTGCTTGCTCTACTTGCCCGCCGACGAGTCGGATAAGAGGAAAAAGGCAATCAAT
GTTTTTGACGCTGGCCTCGAGATTTATCCCAGTAGTAAACTGCGCCATTTCGAAGCCCTGCATAAGCGTACCGGC
CTTGTCTATCAGGATGTTCTCTTTTTCGATGACGAGAGCCGCAATCGCGAGACGGAGCAGTTGGGCGTCACCATG
CGCCTGGTGCGCGACGGCATGACGTGGCATGAGCTTGTCAAGGGCATAGAAGAGTGGCGGTCAAGACGAGAAACA
AGATCAGAAAGGTAA
Gene >OphauG2|7308
ATGCCCCGCAAAGCCTCCAAACAAGCCCCCTCGTCCTCGACACCCACTCCCATCCCCGACTCCTTGTCCGACCCG
TGCCTCCCTCTTCCCGACCTCATCGTCTTTGACCTCGACTACACCCTCTGGCCCTTTTGGGTCGACACACACGTC
ACTCCTCCTCTCCGCTCCAACGCCGCCCATTCTGTAGCCGCCGACGCAAAGGGCGAGACTTTTGCCTTTTATCAC
GACGTGCCCGCCATTCTTCACTTCCTCGCCCGTCGCAACATCAAGTTGGCCGTTGCCTCACGCACAAGTGCCCCT
AGTGTCGCCCGCGACTTGCTTTGCTTGCTCTACTTGCCCGCCGACGAGTCGGATAAGAGGAAAAAGGCAATCAAT
GTTTTTGACGCTGGCCTCGAGATTTATCCCAGTAGTAAACTGCGCCATTTCGAAGCCCTGCATAAGCGTACCGGC
CTTGTCTATCAGGATGTTCTCTTTTTCGATGACGAGAGCCGCAATCGCGAGACGGAGCAGTTGGGCGTCACCATG
CGCCTGGTGCGCGACGGCATGACGTGGCATGAGCTTGTCAAGGGCATAGAAGAGTGGCGGTCAAGACGAGAAACA
AGATCAGAAAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail