Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7307
Gene name
LocationContig_835:7036..7777
Strand-
Gene length (bp)741
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20415 DUF6699 Family of unknown function (DUF6699) 4.4E-06 62 127

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5530
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7307 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7004
Ophiocordyceps camponoti-floridani Ophcf2|01066
Ophiocordyceps kimflemingae Ophio5|8548
Ophiocordyceps subramaniannii Hirsu2|6887

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7307
MTEPLSKVDSAVQGLSSSPPKEKGHRRQSSSAAGVMNINDLMKDGIELELPVETQKTGWKINSSPATIDDTSILK
IPLTKPPVKKIDLHFPLGMEVTARNLKGVTIKDAMDAIHKAYKKRADDELDNPYLAGFEWDKEESWTRLVVHLQK
QPSTSGGGGGKKKKNKKEEE*
Coding >OphauG2|7307
ATGACAGAACCACTCTCCAAAGTTGACTCGGCCGTCCAAGGCCTGTCATCATCGCCGCCCAAGGAAAAGGGCCAT
AGGAGGCAAAGCTCCAGTGCGGCAGGTGTCATGAACATCAATGACCTAATGAAGGATGGAATTGAACTCGAGCTG
CCTGTTGAGACACAAAAGACGGGCTGGAAAATCAACTCGAGCCCTGCAACAATCGATGACACGAGTATCCTCAAG
ATTCCGCTCACGAAACCGCCTGTCAAGAAGATTGATCTGCACTTTCCGCTGGGCATGGAAGTCACGGCAAGAAAT
CTCAAGGGTGTCACCATCAAGGACGCCATGGATGCCATTCACAAGGCATATAAGAAACGAGCCGACGATGAACTA
GACAACCCCTACTTGGCAGGATTCGAATGGGACAAGGAAGAGTCGTGGACGCGATTGGTAGTCCATCTCCAGAAG
CAGCCAAGCACTTCTGGCGGTGGAGGCGGCAAGAAGAAAAAGAACAAGAAGGAAGAAGAGTAG
Transcript >OphauG2|7307
ATGACAGAACCACTCTCCAAAGTTGACTCGGCCGTCCAAGGCCTGTCATCATCGCCGCCCAAGGAAAAGGGCCAT
AGGAGGCAAAGCTCCAGTGCGGCAGGTGTCATGAACATCAATGACCTAATGAAGGATGGAATTGAACTCGAGCTG
CCTGTTGAGACACAAAAGACGGGCTGGAAAATCAACTCGAGCCCTGCAACAATCGATGACACGAGTATCCTCAAG
ATTCCGCTCACGAAACCGCCTGTCAAGAAGATTGATCTGCACTTTCCGCTGGGCATGGAAGTCACGGCAAGAAAT
CTCAAGGGTGTCACCATCAAGGACGCCATGGATGCCATTCACAAGGCATATAAGAAACGAGCCGACGATGAACTA
GACAACCCCTACTTGGCAGGATTCGAATGGGACAAGGAAGAGTCGTGGACGCGATTGGTAGTCCATCTCCAGAAG
CAGCCAAGCACTTCTGGCGGTGGAGGCGGCAAGAAGAAAAAGAACAAGAAGGAAGAAGAGTAG
Gene >OphauG2|7307
ATGACAGAACCACTCTCCAAAGTTGACTCGGCCGTCCAAGGCCTGTCATCATCGCCGCCCAAGGAAAAGGGCCAT
AGGAGGCAAAGCTCCAGTGCGGCAGGTGTCATGAACATCAATGACCTAAGTAACGTGTCCCGACCCGACCTCATG
TAGCATTTGCAGTCTTGCTAGTCCCACTGACACCACGAATTGCATAGTGAAGGATGGAATTGAACTCGAGCTGCC
TGTTGAGACACAAAAGACGGGCTGGTGAGTCCTCCATGGCCCGAGGTCTGAGGCTGTAGTCTTTTTGTATACCGA
GACTGACTGGGACTTGTGTGTCCAGGAAAATCAACTCGAGCCCTGCAACAATCGATGACACGAGTATCCTCAAGA
TTCCGCTCACGAAACCGCCTGTCAAGAAGATTGATCTGCACTTTCCGCTGGGCATGGAAGTCACGGCAAGAAATC
TCAAGGGTGTCACCATCAAGGACGCCATGGATGCCATTCACAAGGCATATAAGAAACGAGTCAGTCTTGTCGTGC
CCTGTTTGGCTCCTGGGCCTTTGCCGTGAGTGAATCAAGATGCACTGACATGTTTACCTCTAGGCCGACGATGAA
CTAGACAACCCCTACTTGGCAGGATTCGAATGGGACAAGGAAGAGTCGTGGACGCGATTGGTAGTCCATCTCCAG
AAGCAGCCAAGCACTTCTGGCGGTGGAGGCGGCAAGAAGAAAAAGAACAAGAAGGAAGAAGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail