Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7306
Gene name
LocationContig_835:3556..5716
Strand-
Gene length (bp)2160
Transcript length (bp)1707
Coding sequence length (bp)1707
Protein length (aa) 569

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.1E-121 70 568

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 4 568 1.0E-99
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 5 568 1.0E-93
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 49 568 7.0E-79
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 27 568 5.0E-75
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 38 568 2.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 4 568 1.0E-99
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 5 568 1.0E-93
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 49 568 7.0E-79
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 27 568 5.0E-75
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 38 568 2.0E-71
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 16 568 3.0E-70
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 47 568 7.0E-65
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 28 568 3.0E-61
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 50 568 1.0E-59
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 54 568 4.0E-59
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 54 568 8.0E-59
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 49 568 9.0E-59
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 54 568 1.0E-57
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 28 568 2.0E-53
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 183 205 22
3 253 275 22
4 327 349 22
5 402 421 19
6 486 508 22
7 513 535 22
8 542 564 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup15
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2590
Ophiocordyceps australis 1348a (Ghana) OphauG2|606
Ophiocordyceps australis 1348a (Ghana) OphauG2|3939
Ophiocordyceps australis 1348a (Ghana) OphauG2|1382
Ophiocordyceps australis 1348a (Ghana) OphauG2|6610
Ophiocordyceps australis 1348a (Ghana) OphauG2|7306 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1724
Ophiocordyceps australis map64 (Brazil) OphauB2|2054
Ophiocordyceps australis map64 (Brazil) OphauB2|237
Ophiocordyceps australis map64 (Brazil) OphauB2|6627
Ophiocordyceps australis map64 (Brazil) OphauB2|7003
Ophiocordyceps australis map64 (Brazil) OphauB2|7976
Ophiocordyceps australis map64 (Brazil) OphauB2|4696
Ophiocordyceps camponoti-floridani Ophcf2|05286
Ophiocordyceps camponoti-floridani Ophcf2|06963
Ophiocordyceps camponoti-floridani Ophcf2|00650
Ophiocordyceps camponoti-floridani Ophcf2|01129
Ophiocordyceps camponoti-rufipedis Ophun1|4690
Ophiocordyceps camponoti-rufipedis Ophun1|6856
Ophiocordyceps camponoti-rufipedis Ophun1|719
Ophiocordyceps camponoti-rufipedis Ophun1|7175
Ophiocordyceps kimflemingae Ophio5|2493
Ophiocordyceps kimflemingae Ophio5|7750
Ophiocordyceps kimflemingae Ophio5|7806
Ophiocordyceps subramaniannii Hirsu2|8734
Ophiocordyceps subramaniannii Hirsu2|7618
Ophiocordyceps subramaniannii Hirsu2|5138
Ophiocordyceps subramaniannii Hirsu2|4609
Ophiocordyceps subramaniannii Hirsu2|1511
Ophiocordyceps subramaniannii Hirsu2|10109

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7306
MHSADPNFPYETLRRIQEFLAIEDVLDNAEKHQELIEEMKLEAALINGNSPYAEVRAVVDNHDDASLPVSTVRAW
TIGIFFSIVLALVNQLFSIRQPSIRFDTNIAQLLAFPLGRAWQRWMPRRTLSIPWTRKTIALNPGPFNKKEHMLI
AIMANTSKSLPYTNYIIWTQVLPHFFNQQYARSFAYIFLNGFATNFIGYGLAGLVRRFLVYPSYCVWPSSLVTIA
LNSALHEERGPSVPGPFGTQWSISRYRFLLYGFAAMFVYFWLPNYLFQVLSYFSWVSWIAPENRELNILAGMQNG
LGLFNPLPTFDWNVICFTTDPLMVPSFSTFNAAAGMFVTGFIVLAVWYSNTWNSGYLPINSNRIFDHFGKAYNVS
AVLDERGMYDEERYLNYSAPYTTAAKALVYGFFFASYSAVVTHVVLHHRYEFKMGLKSLFRELQFKKLLVKLRLK
KKPASDDDALTPGQGQSEYRDIHNRLMAAYQEVPQWWYFCTLIISIVSGVLGIALWPTYTSPAVVLYGIWLCLIF
VVPAGIVLSMTGIEMTLNVLAEFIGGIMVPGNALAMNFFKSYG*
Coding >OphauG2|7306
ATGCACTCTGCGGACCCCAATTTCCCCTACGAAACGTTGAGGCGAATCCAAGAGTTTCTTGCGATTGAGGACGTG
CTTGACAATGCTGAAAAACACCAGGAGCTGATTGAAGAAATGAAGCTCGAGGCGGCGCTCATCAACGGAAACAGC
CCCTATGCTGAAGTGCGCGCAGTGGTTGATAACCACGACGATGCCTCGCTGCCCGTGTCGACGGTGCGGGCGTGG
ACCATTGGCATCTTCTTCTCCATCGTCCTGGCTCTCGTCAACCAGCTCTTTAGCATCCGACAGCCTTCGATCCGG
TTCGACACAAACATTGCGCAGCTGCTCGCGTTTCCTCTCGGCAGGGCATGGCAGCGATGGATGCCTCGCCGCACA
TTGTCGATTCCGTGGACGAGGAAAACAATTGCGCTGAATCCAGGGCCCTTTAACAAAAAGGAGCACATGCTCATC
GCCATCATGGCAAACACGTCCAAGAGCCTGCCCTATACAAACTACATCATCTGGACGCAGGTGCTGCCGCATTTC
TTCAACCAGCAGTACGCGCGCAGCTTTGCCTACATCTTCCTCAACGGCTTTGCCACCAACTTTATTGGCTACGGC
CTCGCGGGCCTGGTTCGACGCTTCCTCGTCTATCCCTCGTACTGCGTGTGGCCGTCGTCGCTCGTCACTATTGCG
CTCAACAGCGCGCTTCACGAGGAGCGTGGCCCGTCGGTCCCAGGGCCCTTTGGAACGCAGTGGTCCATTTCTCGC
TACCGCTTCCTGCTCTACGGCTTCGCGGCCATGTTTGTGTACTTTTGGCTGCCCAACTACCTCTTCCAGGTGCTG
TCGTATTTCTCGTGGGTGAGTTGGATCGCGCCGGAGAACCGAGAGCTCAACATCTTGGCCGGGATGCAAAACGGG
CTCGGGCTCTTTAACCCTCTGCCAACGTTTGACTGGAACGTCATATGCTTCACCACGGACCCCTTGATGGTGCCG
TCCTTTTCCACCTTCAACGCCGCAGCTGGCATGTTTGTCACCGGCTTCATCGTGCTCGCCGTGTGGTACAGCAAC
ACGTGGAACTCGGGCTATCTGCCCATCAACTCGAACCGCATCTTTGACCACTTTGGAAAGGCCTACAACGTGTCG
GCGGTGCTGGACGAGCGCGGCATGTACGACGAAGAGCGCTATCTCAACTACTCGGCTCCCTACACCACGGCGGCA
AAGGCCCTCGTCTACGGCTTCTTCTTTGCCAGCTACTCGGCCGTGGTGACTCATGTGGTGCTTCACCACCGCTAC
GAGTTCAAAATGGGCCTCAAGAGCCTCTTCAGGGAACTCCAGTTCAAGAAGCTGCTGGTCAAGCTCCGCCTGAAG
AAGAAGCCAGCCTCTGACGACGACGCCTTGACGCCTGGCCAGGGACAAAGCGAGTATCGAGACATTCACAATCGA
CTCATGGCTGCCTACCAAGAAGTGCCGCAATGGTGGTATTTTTGCACTCTCATCATCTCCATAGTGTCTGGCGTG
CTCGGCATCGCTCTTTGGCCCACGTATACTTCGCCTGCTGTTGTGCTCTATGGCATTTGGCTCTGCCTGATATTC
GTCGTTCCAGCCGGCATTGTCTTGTCCATGACGGGCATTGAAATGACGCTCAACGTGCTTGCTGAATTCATTGGC
GGCATCATGGTGCCGGGGAATGCTTTGGCCATGAATTTCTTTAAGTCGTATGGGTAA
Transcript >OphauG2|7306
ATGCACTCTGCGGACCCCAATTTCCCCTACGAAACGTTGAGGCGAATCCAAGAGTTTCTTGCGATTGAGGACGTG
CTTGACAATGCTGAAAAACACCAGGAGCTGATTGAAGAAATGAAGCTCGAGGCGGCGCTCATCAACGGAAACAGC
CCCTATGCTGAAGTGCGCGCAGTGGTTGATAACCACGACGATGCCTCGCTGCCCGTGTCGACGGTGCGGGCGTGG
ACCATTGGCATCTTCTTCTCCATCGTCCTGGCTCTCGTCAACCAGCTCTTTAGCATCCGACAGCCTTCGATCCGG
TTCGACACAAACATTGCGCAGCTGCTCGCGTTTCCTCTCGGCAGGGCATGGCAGCGATGGATGCCTCGCCGCACA
TTGTCGATTCCGTGGACGAGGAAAACAATTGCGCTGAATCCAGGGCCCTTTAACAAAAAGGAGCACATGCTCATC
GCCATCATGGCAAACACGTCCAAGAGCCTGCCCTATACAAACTACATCATCTGGACGCAGGTGCTGCCGCATTTC
TTCAACCAGCAGTACGCGCGCAGCTTTGCCTACATCTTCCTCAACGGCTTTGCCACCAACTTTATTGGCTACGGC
CTCGCGGGCCTGGTTCGACGCTTCCTCGTCTATCCCTCGTACTGCGTGTGGCCGTCGTCGCTCGTCACTATTGCG
CTCAACAGCGCGCTTCACGAGGAGCGTGGCCCGTCGGTCCCAGGGCCCTTTGGAACGCAGTGGTCCATTTCTCGC
TACCGCTTCCTGCTCTACGGCTTCGCGGCCATGTTTGTGTACTTTTGGCTGCCCAACTACCTCTTCCAGGTGCTG
TCGTATTTCTCGTGGGTGAGTTGGATCGCGCCGGAGAACCGAGAGCTCAACATCTTGGCCGGGATGCAAAACGGG
CTCGGGCTCTTTAACCCTCTGCCAACGTTTGACTGGAACGTCATATGCTTCACCACGGACCCCTTGATGGTGCCG
TCCTTTTCCACCTTCAACGCCGCAGCTGGCATGTTTGTCACCGGCTTCATCGTGCTCGCCGTGTGGTACAGCAAC
ACGTGGAACTCGGGCTATCTGCCCATCAACTCGAACCGCATCTTTGACCACTTTGGAAAGGCCTACAACGTGTCG
GCGGTGCTGGACGAGCGCGGCATGTACGACGAAGAGCGCTATCTCAACTACTCGGCTCCCTACACCACGGCGGCA
AAGGCCCTCGTCTACGGCTTCTTCTTTGCCAGCTACTCGGCCGTGGTGACTCATGTGGTGCTTCACCACCGCTAC
GAGTTCAAAATGGGCCTCAAGAGCCTCTTCAGGGAACTCCAGTTCAAGAAGCTGCTGGTCAAGCTCCGCCTGAAG
AAGAAGCCAGCCTCTGACGACGACGCCTTGACGCCTGGCCAGGGACAAAGCGAGTATCGAGACATTCACAATCGA
CTCATGGCTGCCTACCAAGAAGTGCCGCAATGGTGGTATTTTTGCACTCTCATCATCTCCATAGTGTCTGGCGTG
CTCGGCATCGCTCTTTGGCCCACGTATACTTCGCCTGCTGTTGTGCTCTATGGCATTTGGCTCTGCCTGATATTC
GTCGTTCCAGCCGGCATTGTCTTGTCCATGACGGGCATTGAAATGACGCTCAACGTGCTTGCTGAATTCATTGGC
GGCATCATGGTGCCGGGGAATGCTTTGGCCATGAATTTCTTTAAGTCGTATGGGTAA
Gene >OphauG2|7306
ATGCACTCTGCGGACCCCAATTTCCCCTACGAAACGTTGAGGCGAATCCAAGAGTTTCTTGGTAGGTGTTTTTTT
GCTTCTTCTCTTGTCACGGGCCTCGGCGGGATTCCAAGCGGCTGGCTGACAATGGCGCAGCGATTGAGGACGTGC
TTGACAATGCTGAAAAACACCAGGAGCTGATTGAAGAAATGAAGCTCGAGGCGGCGCTCATCAACGGAAACAGCC
CCTATGCTGAAGTGCGCGCAGTGGTTGATAACCACGACGATGCCTCGCTGCCCGTGTCGACGGTGCGGGCGTGGA
CCATTGGCATCTTCTTCTCCATCGTCCTGGCTCTCGTCAACCAGCTCTTTAGCATCCGACAGCCTTCGATCCGGT
TCGACACAAACATTGCGCAGCTGCTCGCGTTTCCTCTCGGCAGGGCATGGCAGCGATGGATGCCTCGCCGCACAT
TGTCGATTCCGTGGACGAGGAAAACAATTGCGCTGAATCCAGGGCCCTTTAACAAAAAGGAGCACATGCTCATCG
CCATCATGGCAAACACGTCCAAGAGCCTGCCCTATACAAACTACATCATCTGGACGCAGGTGCTGCCGCATTTCT
TCAACCAGCAGTACGCGCGCAGCTTTGCCTACATCTTCCTCAACGGCTTTGCCACCAACTTTATTGGCTACGGCC
TCGCGGGCCTGGTTCGACGCTTCCTCGTCTATCCCTCGTACTGCGTGTGGCCGTCGTCGCTCGTCACTATTGCGC
TCAACAGCGCGCTTCACGAGGAGCGTGGCCCGTCGGTCCCAGGGCCCTTTGGAACGCAGTGGTCCATTTCTCGCT
ACCGCTTCCTGCTCTACGGCTTCGCGGCCATGTTTGTGTACTTTTGGCTGCCCAACTACCTCTTCCAGGTGCTGT
CGTATTTCTCGTGGGTGAGTTGGATCGCGCCGGAGAACCGAGAGCTCAACATCTTGGCCGGGATGCAAAACGGGC
TCGGGGTAAGTGCCATGAATGCCTCTCAGGACGCGCTGCGGCCTTGTTCTAACGCGGGCCTGGCTTGAAGCTCTT
TAACCCTCTGCCAACGTTTGACTGGAACGTCATATGCTTCACCACGGACCCCTTGGTAAGAAAGCCAAAGCCAAA
ATCAAAAATCAATCAAATCTGACCAGCCGTGCAGATGGTGCCGTCCTTTTCCACCTTCAACGCCGCAGCTGGCAT
GTTTGTCACCGGCTTCATCGTGCTCGCCGTGTGGTACAGCAACACGTGGAACTCGGGCTATCTGCCCATCAACTC
GAACCGCATCTTTGACCACTTTGGAAAGGCCTACAACGTGTCGGCGGTGCTGGACGAGCGCGGCATGTACGACGA
AGAGCGCTATCTCAACTACTCGGCTCCCTACACCACGGCGGCAAAGGCCCTCGTCTACGGCTTCTTCTTTGCCAG
CTACTCGGCCGTGGTGACTCATGTGGTGCTTCACCACCGCTACGAGTTCAAAATGGGCCTCAAGAGCCTCTTCAG
GGAACTCCAGTTCAAGAAGCTGCTGGTCAAGCTCCGCCTGAAGAAGAAGCCAGCCTCTGACGACGACGCCTTGAC
GCCTGGCCAGGGACAAAGCGAGTATCGAGACATTCACAATCGACTCATGGCTGCCTACCAAGAAGGTATGTAGTA
GACCTGGGATGCCGTGCTTGGATCCTGCTAATCCGCAGAGCATAGTGCCGCAATGGTGGTATTTTTGCACTCTCA
TCATCTCCATAGTGTCTGGCGTGCTCGGCATCGCTCTTTGGCCCACGTATACTTCGCCTGCTGTTGTGCTCTATG
GCATTTGGCTCTGCCTGATATTCGTCGTTCCAGCCGGCATTGTCTTGTCCATGACGGGCATTGAAATGACGCTCA
ACGTGCTTGCTGAATTCATTGGCGGCATCATGGTGCCGGGGAATGCTTTGGCCATGAATTTCTTTAAGTCGTATG
GGTGCGTCTTTTCTCCTTTTTCTTCTTCCTCTTCCTCTTCCTCTTCCTCTTCTTTCTCTTCTTCCTCTTCCTCTT
CTCCTTTTCGTGTTTTCCTTCTTTTCTCTTGTGCCGTCTGCCAGCCAGCTAACCTCTCTTGCTCCAGCTACGTCA
CCTGTGCCCACGCCCTGGCCTTTGCCAACGACCTCAAGGTCGCTCATTACGTCAAGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail