Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7300
Gene name
LocationContig_833:7051..7786
Strand+
Gene length (bp)735
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup65
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7300 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4715
Ophiocordyceps camponoti-floridani Ophcf2|02168
Ophiocordyceps camponoti-floridani Ophcf2|04814
Ophiocordyceps camponoti-floridani Ophcf2|06000
Ophiocordyceps camponoti-rufipedis Ophun1|1467
Ophiocordyceps camponoti-rufipedis Ophun1|169
Ophiocordyceps camponoti-rufipedis Ophun1|6192
Ophiocordyceps kimflemingae Ophio5|2277
Ophiocordyceps kimflemingae Ophio5|3034
Ophiocordyceps kimflemingae Ophio5|960
Ophiocordyceps subramaniannii Hirsu2|10179
Ophiocordyceps subramaniannii Hirsu2|1104
Ophiocordyceps subramaniannii Hirsu2|457
Ophiocordyceps subramaniannii Hirsu2|4942
Ophiocordyceps subramaniannii Hirsu2|7062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7300
MRAVAHLLDAIKLWEEYYKTTLSDAYVRVGKETTMWNVWSRDRDWNIWDILRFHWEQTGWLCYYDHNPSLTDGLE
PREAGLLGLFFTDQDGLRSPILKRGQIWTFNKTLACSAQDQAGHSRQVNAITKLFESIKPWASSSWQGVIEARIY
HLRFSTDPFLQALITAWHWGKYICPGTISCTNRLTQGQLWLPRNARDMLRNILNKLRLGQRVCIVHKVPMPIVDK
DTWYISGVGMSPNHGQRFL*
Coding >OphauG2|7300
ATGCGTGCGGTAGCTCACCTGTTAGACGCCATTAAGCTGTGGGAAGAATACTACAAGACCACTCTATCAGATGCC
TATGTCCGAGTCGGCAAGGAAACAACAATGTGGAACGTGTGGTCCCGGGATCGAGACTGGAACATTTGGGACATC
TTACGCTTCCATTGGGAACAGACGGGATGGCTTTGCTACTACGATCACAACCCCAGCCTGACAGATGGACTCGAG
CCAAGAGAAGCTGGCCTACTTGGTCTCTTTTTTACAGATCAGGATGGCCTTCGATCACCCATATTAAAAAGAGGC
CAGATTTGGACTTTCAACAAGACGCTTGCCTGCTCTGCCCAAGACCAGGCCGGTCATTCACGTCAGGTCAATGCC
ATAACCAAGCTCTTTGAGAGCATAAAACCCTGGGCCTCTTCTTCGTGGCAAGGAGTCATAGAAGCTCGGATTTAT
CATCTACGCTTTTCCACTGACCCCTTTCTACAAGCTCTCATTACTGCATGGCACTGGGGCAAATACATCTGTCCT
GGCACCATATCATGTACCAACCGCTTGACGCAGGGCCAGTTATGGTTACCAAGAAATGCACGCGATATGCTTCGA
AATATTCTTAACAAGCTACGTCTAGGCCAAAGGGTTTGTATTGTCCACAAGGTACCGATGCCAATAGTCGACAAG
GACACGTGGTATATCTCAGGGGTAGGCATGTCTCCTAATCATGGACAAAGATTTCTGTGA
Transcript >OphauG2|7300
ATGCGTGCGGTAGCTCACCTGTTAGACGCCATTAAGCTGTGGGAAGAATACTACAAGACCACTCTATCAGATGCC
TATGTCCGAGTCGGCAAGGAAACAACAATGTGGAACGTGTGGTCCCGGGATCGAGACTGGAACATTTGGGACATC
TTACGCTTCCATTGGGAACAGACGGGATGGCTTTGCTACTACGATCACAACCCCAGCCTGACAGATGGACTCGAG
CCAAGAGAAGCTGGCCTACTTGGTCTCTTTTTTACAGATCAGGATGGCCTTCGATCACCCATATTAAAAAGAGGC
CAGATTTGGACTTTCAACAAGACGCTTGCCTGCTCTGCCCAAGACCAGGCCGGTCATTCACGTCAGGTCAATGCC
ATAACCAAGCTCTTTGAGAGCATAAAACCCTGGGCCTCTTCTTCGTGGCAAGGAGTCATAGAAGCTCGGATTTAT
CATCTACGCTTTTCCACTGACCCCTTTCTACAAGCTCTCATTACTGCATGGCACTGGGGCAAATACATCTGTCCT
GGCACCATATCATGTACCAACCGCTTGACGCAGGGCCAGTTATGGTTACCAAGAAATGCACGCGATATGCTTCGA
AATATTCTTAACAAGCTACGTCTAGGCCAAAGGGTTTGTATTGTCCACAAGGTACCGATGCCAATAGTCGACAAG
GACACGTGGTATATCTCAGGGGTAGGCATGTCTCCTAATCATGGACAAAGATTTCTGTGA
Gene >OphauG2|7300
ATGCGTGCGGTAGCTCACCTGTTAGACGCCATTAAGCTGTGGGAAGAATACTACAAGACCACTCTATCAGATGCC
TATGTCCGAGTCGGCAAGGAAACAACAATGTGGAACGTGTGGTCCCGGGATCGAGACTGGAACATTTGGGACATC
TTACGCTTCCATTGGGAACAGACGGGATGGCTTTGCTACTACGATCACAACCCCAGCCTGACAGATGGACTCGAG
CCAAGAGAAGCTGGCCTACTTGGTCTCTTTTTTACAGATCAGGATGGCCTTCGATCACCCATATTAAAAAGAGGC
CAGATTTGGACTTTCAACAAGACGCTTGCCTGCTCTGCCCAAGACCAGGCCGGTCATTCACGTCAGGTCAATGCC
ATAACCAAGCTCTTTGAGAGCATAAAACCCTGGGCCTCTTCTTCGTGGCAAGGAGTCATAGAAGCTCGGATTTAT
CATCTACGCTTTTCCACTGACCCCTTTCTACAAGCTCTCATTACTGCATGGCACTGGGGCAAATACATCTGTCCT
GGCACCATATCATGTACCAACCGCTTGACGCAGGGCCAGTTATGGTTACCAAGAAATGCACGCGATATGCTTCGA
AATATTCTTAACAAGCTACGTCTAGGCCAAAGGGTTTGTATTGTCCACAAGGTACCGATGCCAATAGTCGACAAG
GACACGTGGTATATCTCAGGGGTAGGCATGTCTCCTAATCATGGACAAAGATTTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail