Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7296
Gene name
LocationContig_832:3813..4684
Strand+
Gene length (bp)871
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01191 RNA_pol_Rpb5_C RNA polymerase Rpb5, C-terminal domain 1.6E-31 160 232
PF03871 RNA_pol_Rpb5_N RNA polymerase Rpb5, N-terminal domain 7.0E-26 12 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09191|RPAB1_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb5 PE=1 SV=1 9 232 7.0E-68
sp|Q757H7|RPAB1_ASHGO DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB5 PE=3 SV=1 12 233 2.0E-67
sp|P20434|RPAB1_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB5 PE=1 SV=1 12 233 5.0E-67
sp|Q6BIJ0|RPAB1_DEBHA DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPB5 PE=3 SV=1 12 233 4.0E-66
sp|Q6CJ62|RPAB1_KLULA DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPB5 PE=3 SV=1 7 233 8.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09191|RPAB1_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb5 PE=1 SV=1 9 232 7.0E-68
sp|Q757H7|RPAB1_ASHGO DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB5 PE=3 SV=1 12 233 2.0E-67
sp|P20434|RPAB1_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB5 PE=1 SV=1 12 233 5.0E-67
sp|Q6BIJ0|RPAB1_DEBHA DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPB5 PE=3 SV=1 12 233 4.0E-66
sp|Q6CJ62|RPAB1_KLULA DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPB5 PE=3 SV=1 7 233 8.0E-66
sp|Q9P4B9|RPAB1_KLUMA DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Kluyveromyces marxianus GN=RPB5 PE=3 SV=1 7 233 3.0E-65
sp|Q6FQA6|RPAB1_CANGA DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB5 PE=3 SV=1 12 233 4.0E-65
sp|Q6CA26|RPAB1_YARLI DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPB5 PE=3 SV=1 11 233 3.0E-64
sp|Q9N5K2|RPAB1_CAEEL DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Caenorhabditis elegans GN=rpb-5 PE=3 SV=1 13 233 9.0E-52
sp|A8XGH1|RPAB1_CAEBR DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Caenorhabditis briggsae GN=rpb-5 PE=3 SV=1 13 233 3.0E-50
sp|Q5R587|RPAB1_PONAB DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Pongo abelii GN=POLR2E PE=2 SV=1 11 232 3.0E-50
sp|B0BNE2|RPAB1_RAT DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Rattus norvegicus GN=Polr2e PE=2 SV=1 11 232 5.0E-50
sp|Q80UW8|RPAB1_MOUSE DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Mus musculus GN=Polr2e PE=1 SV=1 11 232 5.0E-50
sp|Q2T9T3|RPAB1_BOVIN DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Bos taurus GN=POLR2E PE=2 SV=1 11 232 3.0E-49
sp|P19388|RPAB1_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens GN=POLR2E PE=1 SV=4 11 232 2.0E-48
sp|O81098|RPB5A_ARATH DNA-directed RNA polymerases II and IV subunit 5A OS=Arabidopsis thaliana GN=NRPB5A PE=1 SV=1 12 233 2.0E-42
sp|Q54EH2|RPAB1_DICDI DNA-directed RNA polymerases I, II, and III subunit rpabc1 OS=Dictyostelium discoideum GN=polr2e PE=3 SV=2 12 233 8.0E-42
sp|Q9FJL8|RP5L1_ARATH DNA-directed RNA polymerase subunit 5-like protein 1 OS=Arabidopsis thaliana GN=NRPB5L1 PE=3 SV=1 13 233 1.0E-32
sp|Q9ZVB9|RPD5B_ARATH DNA-directed RNA polymerases IV and V subunit 5B OS=Arabidopsis thaliana GN=NRPD5B PE=1 SV=1 11 233 4.0E-26
sp|Q9M1J2|RPE5A_ARATH DNA-directed RNA polymerase V subunit 5A OS=Arabidopsis thaliana GN=NRPE5A PE=1 SV=1 8 233 4.0E-26
sp|Q9M1H8|RPE5C_ARATH DNA-directed RNA polymerase V subunit 5C OS=Arabidopsis thaliana GN=NRPE5C PE=2 SV=1 8 233 3.0E-23
sp|A1RWW7|RPOH_THEPD DNA-directed RNA polymerase subunit H OS=Thermofilum pendens (strain Hrk 5) GN=rpoH PE=3 SV=1 161 233 2.0E-14
sp|P31815|RPOH_THECE DNA-directed RNA polymerase subunit H OS=Thermococcus celer GN=rpoH PE=3 SV=1 161 233 5.0E-14
sp|Q58443|RPOH_METJA DNA-directed RNA polymerase subunit H OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoH PE=1 SV=1 160 233 5.0E-14
sp|P61519|RPOH_METMP DNA-directed RNA polymerase subunit H OS=Methanococcus maripaludis (strain S2 / LL) GN=rpoH PE=3 SV=1 160 233 7.0E-14
sp|O27122|RPOH_METTH DNA-directed RNA polymerase subunit H OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoH PE=1 SV=1 161 232 3.0E-13
sp|C6A1F8|RPOH_THESM DNA-directed RNA polymerase subunit H OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpoH PE=3 SV=1 160 233 1.0E-12
sp|Q9V116|RPOH_PYRAB DNA-directed RNA polymerase subunit H OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoH PE=3 SV=1 161 224 1.0E-12
sp|O28394|RPOH_ARCFU DNA-directed RNA polymerase subunit H OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoH PE=3 SV=1 165 233 2.0E-12
sp|P41559|RPOH_METVS DNA-directed RNA polymerase subunit H OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoH PE=3 SV=1 160 233 2.0E-12
sp|C5A210|RPOH_THEGJ DNA-directed RNA polymerase subunit H OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpoH PE=3 SV=1 161 233 2.0E-12
sp|A4FWF9|RPOH_METM5 DNA-directed RNA polymerase subunit H OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpoH PE=3 SV=1 160 233 5.0E-12
sp|Q8PUQ8|RPOH_METMA DNA-directed RNA polymerase subunit H OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoH PE=3 SV=1 161 233 6.0E-12
sp|O74019|RPOH_PYRHO DNA-directed RNA polymerase subunit H OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoH PE=3 SV=1 161 224 6.0E-12
sp|A3DMP2|RPOH_STAMF DNA-directed RNA polymerase subunit H OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpoH PE=3 SV=1 161 233 6.0E-12
sp|Q464Y4|RPOH_METBF DNA-directed RNA polymerase subunit H OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpoH PE=3 SV=1 165 233 7.0E-12
sp|A9A9V3|RPOH_METM6 DNA-directed RNA polymerase subunit H OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpoH PE=3 SV=1 160 233 9.0E-12
sp|A6UV53|RPOH_META3 DNA-directed RNA polymerase subunit H OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpoH PE=3 SV=1 160 233 9.0E-12
sp|Q2NEK1|RPOH_METST DNA-directed RNA polymerase subunit H OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpoH PE=3 SV=1 161 232 1.0E-11
sp|A2SSM7|RPOH_METLZ DNA-directed RNA polymerase subunit H OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpoH PE=3 SV=1 160 233 1.0E-11
sp|Q976A3|RPOH_SULTO DNA-directed RNA polymerase subunit H OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoH PE=3 SV=2 160 233 2.0E-11
sp|Q8TRB4|RPOH_METAC DNA-directed RNA polymerase subunit H OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoH PE=3 SV=1 165 233 2.0E-11
sp|Q8U0M2|RPOH_PYRFU DNA-directed RNA polymerase subunit H OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoH PE=3 SV=1 161 224 2.0E-11
sp|P11521|RPOH_SULAC DNA-directed RNA polymerase subunit H OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoH PE=1 SV=2 160 233 2.0E-11
sp|A6VGU6|RPOH_METM7 DNA-directed RNA polymerase subunit H OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpoH PE=3 SV=1 160 233 4.0E-11
sp|Q12WS3|RPOH_METBU DNA-directed RNA polymerase subunit H OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpoH PE=3 SV=1 165 233 4.0E-11
sp|A9A458|RPOH_NITMS DNA-directed RNA polymerase subunit H OS=Nitrosopumilus maritimus (strain SCM1) GN=rpoH PE=3 SV=1 165 233 4.0E-10
sp|B6YT14|RPOH_THEON DNA-directed RNA polymerase subunit H OS=Thermococcus onnurineus (strain NA1) GN=rpoH PE=3 SV=1 161 233 6.0E-10
sp|A0B555|RPOH_METTP DNA-directed RNA polymerase subunit H OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpoH PE=3 SV=1 165 233 7.0E-10
sp|C3NFS5|RPOH_SULIN DNA-directed RNA polymerase subunit H OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoH PE=3 SV=1 165 233 8.0E-10
sp|C3MZM6|RPOH_SULIA DNA-directed RNA polymerase subunit H OS=Sulfolobus islandicus (strain M.16.27) GN=rpoH PE=3 SV=1 165 233 8.0E-10
sp|C4KIV6|RPOH_SULIK DNA-directed RNA polymerase subunit H OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoH PE=3 SV=1 165 233 8.0E-10
sp|C3MRK1|RPOH_SULIL DNA-directed RNA polymerase subunit H OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoH PE=3 SV=1 165 233 8.0E-10
sp|C3MY97|RPOH_SULIM DNA-directed RNA polymerase subunit H OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoH PE=3 SV=1 165 233 8.0E-10
sp|C3N7P8|RPOH_SULIY DNA-directed RNA polymerase subunit H OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoH PE=3 SV=1 165 233 8.0E-10
sp|Q9YAT3|RPOH_AERPE DNA-directed RNA polymerase subunit H OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpoH PE=3 SV=1 162 233 1.0E-09
sp|Q980Q9|RPOH_SULSO DNA-directed RNA polymerase subunit H OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoH PE=1 SV=1 165 233 2.0E-09
sp|Q5UPX7|RPO5_MIMIV DNA-directed RNA polymerase subunit 5 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L235 PE=1 SV=1 91 233 5.0E-09
sp|A2BN32|RPOH_HYPBU DNA-directed RNA polymerase subunit H OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpoH PE=3 SV=1 161 224 8.0E-09
sp|Q8ZYR0|RPOH_PYRAE DNA-directed RNA polymerase subunit H OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpoH PE=3 SV=1 173 233 8.0E-09
sp|Q5JE31|RPOH_THEKO DNA-directed RNA polymerase subunit H OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoH PE=1 SV=1 161 233 1.0E-08
sp|P0CX06|RPOH_HALSA DNA-directed RNA polymerase subunit H OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoH PE=3 SV=1 159 233 1.0E-08
sp|B0R8D7|RPOH_HALS3 DNA-directed RNA polymerase subunit H OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoH PE=3 SV=1 159 233 1.0E-08
sp|Q979F2|RPOH_THEVO DNA-directed RNA polymerase subunit H OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpoH PE=3 SV=2 161 232 3.0E-08
sp|A4YCQ7|RPOH_METS5 DNA-directed RNA polymerase subunit H OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoH PE=3 SV=1 165 233 1.0E-07
sp|Q03588|RPOH_THEAC DNA-directed RNA polymerase subunit H OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoH PE=3 SV=1 161 232 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0090304 nucleic acid metabolic process No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7296
MDDNVQNDAKSKEVVRLWRAWRTVHEMIVDREYELADDEINISLDRFRSEYCAPDGTVNRAKLQFSARPSDAMLR
KATPPATEANPDPVPDCGPIWVEFLAEKTFGVAQIRVFAKYVVDNNYKAGIIVTHGALSPAARKSLANLENLTRL
ECFLEDDLLVNITHHELVPRHVVLSRDEKTALLKRYRLKETQLPRILQKDPIARYLGLRRGQVVKIIRVSETAGR
YASYRLCV*
Coding >OphauG2|7296
ATGGATGACAATGTGCAAAACGATGCCAAGTCAAAGGAGGTGGTGAGGCTATGGCGAGCATGGAGAACGGTACAT
GAAATGATTGTCGATAGGGAATACGAGCTTGCCGACGATGAAATCAACATTTCTCTCGATCGCTTCCGCTCCGAG
TACTGTGCCCCAGACGGCACTGTCAACCGCGCGAAACTCCAGTTTTCAGCGCGTCCAAGCGACGCCATGCTTCGC
AAGGCCACGCCCCCGGCCACGGAAGCAAACCCCGATCCCGTGCCCGACTGCGGCCCCATCTGGGTAGAGTTTCTC
GCCGAAAAGACGTTTGGCGTGGCCCAGATTCGCGTCTTTGCAAAATACGTCGTGGATAACAACTACAAGGCCGGC
ATCATTGTTACCCATGGCGCCCTCTCCCCCGCAGCCCGCAAATCACTCGCAAACCTTGAAAATCTTACCCGCCTC
GAGTGCTTCCTCGAAGACGATCTGCTCGTCAACATTACGCATCATGAGCTCGTGCCCCGCCATGTTGTTCTCTCG
CGCGATGAAAAGACGGCCCTACTCAAACGTTATCGCCTCAAGGAAACACAACTGCCCCGAATCTTGCAAAAGGAT
CCCATTGCTCGGTATCTAGGTCTTCGCCGCGGCCAAGTGGTAAAAATCATCCGTGTCAGTGAAACGGCTGGCCGA
TATGCGAGTTACAGATTATGTGTGTAG
Transcript >OphauG2|7296
ATGGATGACAATGTGCAAAACGATGCCAAGTCAAAGGAGGTGGTGAGGCTATGGCGAGCATGGAGAACGGTACAT
GAAATGATTGTCGATAGGGAATACGAGCTTGCCGACGATGAAATCAACATTTCTCTCGATCGCTTCCGCTCCGAG
TACTGTGCCCCAGACGGCACTGTCAACCGCGCGAAACTCCAGTTTTCAGCGCGTCCAAGCGACGCCATGCTTCGC
AAGGCCACGCCCCCGGCCACGGAAGCAAACCCCGATCCCGTGCCCGACTGCGGCCCCATCTGGGTAGAGTTTCTC
GCCGAAAAGACGTTTGGCGTGGCCCAGATTCGCGTCTTTGCAAAATACGTCGTGGATAACAACTACAAGGCCGGC
ATCATTGTTACCCATGGCGCCCTCTCCCCCGCAGCCCGCAAATCACTCGCAAACCTTGAAAATCTTACCCGCCTC
GAGTGCTTCCTCGAAGACGATCTGCTCGTCAACATTACGCATCATGAGCTCGTGCCCCGCCATGTTGTTCTCTCG
CGCGATGAAAAGACGGCCCTACTCAAACGTTATCGCCTCAAGGAAACACAACTGCCCCGAATCTTGCAAAAGGAT
CCCATTGCTCGGTATCTAGGTCTTCGCCGCGGCCAAGTGGTAAAAATCATCCGTGTCAGTGAAACGGCTGGCCGA
TATGCGAGTTACAGATTATGTGTGTAG
Gene >OphauG2|7296
ATGGATGACAATGTGCAAAACGATGCCAAGTCAAAGGAGGTGGTGAGGCTATGGCGAGCATGGAGAACGGTACAT
GAAATGATTGTCGATAGGGTACGTGTCTCGGATAGCGGTTGGACGCGCCTCAAAGATTTCCGCGTCAGGGCTCAC
CTCTTGCTGCGCAGGAATACGAGCTTGCCGACGATGAAATCAACATTTCTCTCGATCGCTTCCGCTCCGAGTACT
GTGCCCCAGACGGCACTGTCAAGTACGTGCCAAGATCAAATTGCCCGTCCGTGTTGCAAGCTACATGCGTTGCCT
TTGAAATAACACAAGAGCTCACTCGCACAAAAAAAAAAAAAATAGCCGCGCGAAACTCCAGTTTTCAGCGCGTCC
AAGCGACGCCATGCTTCGCAAGGCCACGCCCCCGGCCACGGAAGCAAACCCCGATCCCGTGCCCGACTGCGGCCC
CATCTGGGTAGAGTTTCTCGCCGAAAAGACGTTTGGCGTGGCCCAGATTCGCGTCTTTGCAAAATACGTCGTGGA
TAACAACTACAAGGCCGGCATCATTGTTACCCATGGCGCCCTCTCCCCCGCAGCCCGCAAATCACTCGCAAACCT
TGAAAATCTTACCCGCCTCGAGTGCTTCCTCGAAGACGATCTGCTCGTCAACATTACGCATCATGAGCTCGTGCC
CCGCCATGTTGTTCTCTCGCGCGATGAAAAGACGGCCCTACTCAAACGTTATCGCCTCAAGGAAACACAACTGCC
CCGAATCTTGCAAAAGGATCCCATTGCTCGGTATCTAGGTCTTCGCCGCGGCCAAGTGGTAAAAATCATCCGTGT
CAGTGAAACGGCTGGCCGATATGCGAGTTACAGATTATGTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail