Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7290
Gene name
LocationContig_831:2809..3475
Strand-
Gene length (bp)666
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02636 Methyltransf_28 Putative S-adenosyl-L-methionine-dependent methyltransferase 1.3E-29 16 149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09644|NDUF7_CAEEL NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog OS=Caenorhabditis elegans GN=ZK1128.1 PE=3 SV=4 24 216 1.0E-16
sp|Q5BKM6|NDUF7_XENTR NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Xenopus tropicalis GN=ndufaf7 PE=2 SV=1 51 208 8.0E-16
sp|Q54S83|NDUF7_DICDI NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Dictyostelium discoideum GN=midA PE=1 SV=1 65 216 1.0E-15
sp|Q5XI79|NDUF7_RAT NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Rattus norvegicus GN=Ndufaf7 PE=2 SV=1 55 208 2.0E-15
sp|Q6GQ37|NDUF7_XENLA NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Xenopus laevis GN=ndufaf7 PE=2 SV=1 51 208 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09644|NDUF7_CAEEL NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog OS=Caenorhabditis elegans GN=ZK1128.1 PE=3 SV=4 24 216 1.0E-16
sp|Q5BKM6|NDUF7_XENTR NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Xenopus tropicalis GN=ndufaf7 PE=2 SV=1 51 208 8.0E-16
sp|Q54S83|NDUF7_DICDI NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Dictyostelium discoideum GN=midA PE=1 SV=1 65 216 1.0E-15
sp|Q5XI79|NDUF7_RAT NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Rattus norvegicus GN=Ndufaf7 PE=2 SV=1 55 208 2.0E-15
sp|Q6GQ37|NDUF7_XENLA NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Xenopus laevis GN=ndufaf7 PE=2 SV=1 51 208 5.0E-15
sp|Q08BY0|NDUF7_DANRE NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Danio rerio GN=ndufaf7 PE=2 SV=1 55 204 6.0E-15
sp|Q9CWG8|NDUF7_MOUSE NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Mus musculus GN=Ndufaf7 PE=1 SV=4 55 208 4.0E-14
sp|Q7L592|NDUF7_HUMAN NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Homo sapiens GN=NDUFAF7 PE=1 SV=1 55 211 3.0E-13
sp|Q2KHV5|NDUF7_BOVIN NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 OS=Bos taurus GN=NDUFAF7 PE=2 SV=2 55 208 1.0E-12
sp|Q9VGR2|NDUF7_DROME NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog OS=Drosophila melanogaster GN=CG17726 PE=1 SV=1 85 205 2.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5116
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7290 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|824
Ophiocordyceps camponoti-floridani Ophcf2|05656
Ophiocordyceps camponoti-rufipedis Ophun1|812
Ophiocordyceps kimflemingae Ophio5|6275
Ophiocordyceps subramaniannii Hirsu2|3321

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7290
MVATNPLNTAASSSSTGRSPEFQLMLSKCTTRHSRYLPETSLRYRRLKQVPDATIEICPDASLFAAEIATRIGGS
SLHPKPSPSGAALIIDYGTFGSVPVNSLRGIRSHRSVHPLSSPGLVDLSADVDFTSIAENSTLASDGVEVHGPVF
QADFLELMGIRERAAMLTKSLDKTAAQGFERAWKRLIDRGLNGMGKVYKALAIIPENQGRRRPAGFGGDVT*
Coding >OphauG2|7290
ATGGTGGCAACAAACCCACTCAACACAGCAGCCTCCAGCTCGTCAACAGGCAGGTCTCCAGAGTTCCAACTGATG
CTTTCAAAATGCACAACAAGACATTCACGTTATTTGCCAGAGACTTCGTTGAGATATCGTCGACTCAAGCAAGTT
CCCGACGCCACTATTGAAATATGTCCCGACGCCTCTCTCTTTGCAGCTGAAATTGCAACTCGCATCGGCGGCTCC
TCGTTGCACCCCAAGCCATCTCCCAGCGGCGCTGCTTTGATCATTGACTATGGTACTTTCGGCTCCGTTCCCGTC
AACTCTTTGCGCGGAATTCGTAGTCACCGCTCCGTTCATCCCCTTTCCTCACCTGGCCTGGTCGACTTGAGTGCC
GATGTAGACTTTACTTCGATTGCAGAAAATTCAACACTGGCAAGTGACGGCGTCGAGGTTCATGGACCTGTTTTT
CAGGCTGATTTTCTTGAACTAATGGGCATTCGTGAGCGCGCCGCTATGCTCACAAAAAGCCTTGATAAGACTGCT
GCTCAAGGCTTCGAAAGGGCCTGGAAACGTCTTATTGACCGCGGCCTCAACGGTATGGGCAAGGTATACAAGGCT
TTGGCCATTATCCCCGAAAATCAAGGCAGACGACGTCCCGCTGGCTTTGGAGGTGATGTGACATGA
Transcript >OphauG2|7290
ATGGTGGCAACAAACCCACTCAACACAGCAGCCTCCAGCTCGTCAACAGGCAGGTCTCCAGAGTTCCAACTGATG
CTTTCAAAATGCACAACAAGACATTCACGTTATTTGCCAGAGACTTCGTTGAGATATCGTCGACTCAAGCAAGTT
CCCGACGCCACTATTGAAATATGTCCCGACGCCTCTCTCTTTGCAGCTGAAATTGCAACTCGCATCGGCGGCTCC
TCGTTGCACCCCAAGCCATCTCCCAGCGGCGCTGCTTTGATCATTGACTATGGTACTTTCGGCTCCGTTCCCGTC
AACTCTTTGCGCGGAATTCGTAGTCACCGCTCCGTTCATCCCCTTTCCTCACCTGGCCTGGTCGACTTGAGTGCC
GATGTAGACTTTACTTCGATTGCAGAAAATTCAACACTGGCAAGTGACGGCGTCGAGGTTCATGGACCTGTTTTT
CAGGCTGATTTTCTTGAACTAATGGGCATTCGTGAGCGCGCCGCTATGCTCACAAAAAGCCTTGATAAGACTGCT
GCTCAAGGCTTCGAAAGGGCCTGGAAACGTCTTATTGACCGCGGCCTCAACGGTATGGGCAAGGTATACAAGGCT
TTGGCCATTATCCCCGAAAATCAAGGCAGACGACGTCCCGCTGGCTTTGGAGGTGATGTGACATGA
Gene >OphauG2|7290
ATGGTGGCAACAAACCCACTCAACACAGCAGCCTCCAGCTCGTCAACAGGCAGGTCTCCAGAGTTCCAACTGATG
CTTTCAAAATGCACAACAAGACATTCACGTTATTTGCCAGAGACTTCGTTGAGATATCGTCGACTCAAGCAAGTT
CCCGACGCCACTATTGAAATATGTCCCGACGCCTCTCTCTTTGCAGCTGAAATTGCAACTCGCATCGGCGGCTCC
TCGTTGCACCCCAAGCCATCTCCCAGCGGCGCTGCTTTGATCATTGACTATGGTACTTTCGGCTCCGTTCCCGTC
AACTCTTTGCGCGGAATTCGTAGTCACCGCTCCGTTCATCCCCTTTCCTCACCTGGCCTGGTCGACTTGAGTGCC
GATGTAGACTTTACTTCGATTGCAGAAAATTCAACACTGGCAAGTGACGGCGTCGAGGTTCATGGACCTGTTTTT
CAGGCTGATTTTCTTGAACTAATGGGCATTCGTGAGCGCGCCGCTATGCTCACAAAAAGCCTTGATAAGACTGCT
GCTCAAGGCTTCGAAAGGGCCTGGAAACGTCTTATTGACCGCGGCCTCAACGGTATGGGCAAGGTATACAAGGCT
TTGGCCATTATCCCCGAAAATCAAGGCAGACGACGTCCCGCTGGCTTTGGAGGTGATGTGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail