Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7281
Gene name
LocationContig_83:25487..28048
Strand-
Gene length (bp)2561
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12862 ANAPC5 Anaphase-promoting complex subunit 5 2.2E-33 286 375
PF12862 ANAPC5 Anaphase-promoting complex subunit 5 8.4E+00 598 667

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4W7|APC5_SCHPO Anaphase-promoting complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc5 PE=1 SV=3 5 647 2.0E-43
sp|Q08683|APC5_YEAST Anaphase-promoting complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC5 PE=1 SV=1 275 378 3.0E-11
sp|Q8BTZ4|APC5_MOUSE Anaphase-promoting complex subunit 5 OS=Mus musculus GN=Anapc5 PE=1 SV=1 263 685 1.0E-06
sp|Q5RE52|APC5_PONAB Anaphase-promoting complex subunit 5 OS=Pongo abelii GN=ANAPC5 PE=2 SV=1 263 685 1.0E-06
sp|Q9UJX4|APC5_HUMAN Anaphase-promoting complex subunit 5 OS=Homo sapiens GN=ANAPC5 PE=1 SV=2 263 685 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4W7|APC5_SCHPO Anaphase-promoting complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc5 PE=1 SV=3 5 647 2.0E-43
sp|Q08683|APC5_YEAST Anaphase-promoting complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC5 PE=1 SV=1 275 378 3.0E-11
sp|Q8BTZ4|APC5_MOUSE Anaphase-promoting complex subunit 5 OS=Mus musculus GN=Anapc5 PE=1 SV=1 263 685 1.0E-06
sp|Q5RE52|APC5_PONAB Anaphase-promoting complex subunit 5 OS=Pongo abelii GN=ANAPC5 PE=2 SV=1 263 685 1.0E-06
sp|Q9UJX4|APC5_HUMAN Anaphase-promoting complex subunit 5 OS=Homo sapiens GN=ANAPC5 PE=1 SV=2 263 685 1.0E-06
sp|A1L1K3|APC5_RAT Anaphase-promoting complex subunit 5 OS=Rattus norvegicus GN=Anapc5 PE=2 SV=1 263 374 2.0E-06
sp|Q5ZKK3|APC5_CHICK Anaphase-promoting complex subunit 5 OS=Gallus gallus GN=ANAPC5 PE=2 SV=1 264 369 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7281 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5071
Ophiocordyceps camponoti-floridani Ophcf2|06139
Ophiocordyceps camponoti-rufipedis Ophun1|4425
Ophiocordyceps kimflemingae Ophio5|3765
Ophiocordyceps subramaniannii Hirsu2|2090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7281
MARHVSPSNIGLLILVELYADGAILGNAVLPVLSFLASHILTDMTPSHGPASARASRWNKTQSIVNLIVSIKSFE
ELLGSYAFIMGMPGRRLWDEFLHKLWAIDSLNALHEFFERLLLLQQAAHGTLPSGNNSHHQAANRVRLSYNSPFG
VFVRKACLEFKRLHFHECADLWKDLVRYRQPTAQYIRRRNHSFAPLSFDSVLLHSDAEWGHDATSAVAKVAYGGM
LVGPGIGQQRGRIAASTDEIECLLDFQVERMQKFGSRVPVSLRHKFGQLLHDSYLVPSVTHYLSYLDAWRAGDYT
TSFDLLHRYFDYTMQYRDRLFYQYALMNLAVLQADFGCHKEAVSAMLETVSTARENRDMTCLNFALNWLFHFGRA
HPQLVQNLQPDNQMGFGKESLTFLRVKAKETGMWSLWSSVLLSEAKLALVHGDSLASCTENMARSSQLIVDKNMA
SMMGAQLSLKAALWNRAGLTQLSTLTSEVFLRCYATNCVFDEELKHVCRISIALCERGRFDQALERLQNLDQNSL
RSWKSNQYWHKYKAIVKLKRNLHHHNLDGAGEILEQLLQSKDDDFEPDLTFFIDSLNIDYLSRRGDLVSAFLYLD
RLRHKYDDDSKDIALRIKLLLLKVSLFQRCGRVQRAFSTVIRAARMAKRARQGYCLLQALMALANILVSMAEFEA
ALNVVHSIMPHAYECESWAMTAQIYGLEADAFMGIAGSMEIKSRGRNRCLKRALAAVQKAYEQYSWIEESQRKCE
MMAKKAVIMKLAGEVMLAADYAAASVELRTKAKALSLVKV*
Coding >OphauG2|7281
ATGGCTCGCCATGTCAGCCCTTCCAATATTGGCCTGCTCATCCTAGTGGAGCTATACGCAGACGGTGCCATCTTG
GGCAACGCCGTCCTGCCTGTTCTGTCCTTTCTCGCCTCGCATATACTAACCGACATGACGCCGAGCCATGGCCCT
GCATCCGCCAGAGCCTCACGCTGGAACAAGACGCAAAGCATCGTCAACCTCATTGTCAGCATCAAGAGTTTTGAG
GAGCTTCTTGGGAGCTATGCCTTCATCATGGGCATGCCTGGAAGGAGGCTTTGGGACGAGTTCCTCCACAAGCTG
TGGGCCATTGACTCTCTCAATGCCCTACATGAGTTTTTCGAGAGATTATTACTGCTGCAACAGGCGGCTCATGGG
ACTTTGCCTTCGGGCAACAATAGTCATCATCAAGCCGCCAACAGGGTCCGGCTTTCCTACAACTCTCCATTTGGA
GTCTTTGTCCGCAAAGCATGTCTCGAGTTCAAGAGACTCCACTTCCACGAATGCGCCGACTTGTGGAAGGACCTT
GTTCGATATCGCCAACCCACCGCGCAGTATATCCGACGCAGAAACCACAGCTTTGCTCCCCTGAGCTTCGACAGC
GTCTTGCTGCACAGCGATGCCGAGTGGGGGCACGATGCCACGTCTGCCGTGGCCAAAGTCGCCTATGGTGGCATG
CTTGTTGGGCCCGGCATTGGTCAACAGCGTGGCAGAATCGCCGCCAGCACCGATGAAATTGAGTGTTTGCTCGAC
TTTCAAGTGGAACGGATGCAAAAATTCGGCAGCAGAGTGCCTGTCTCGCTTCGCCACAAATTTGGCCAGCTGCTC
CATGATAGCTACCTAGTCCCAAGCGTGACACACTATCTCAGTTATCTCGATGCTTGGCGAGCAGGCGACTATACC
ACGTCGTTTGACCTGCTCCACCGTTATTTCGATTACACAATGCAATACCGCGATCGACTCTTCTACCAGTATGCA
CTCATGAACCTGGCTGTCTTGCAAGCAGACTTTGGCTGCCACAAAGAAGCCGTGTCAGCCATGCTTGAGACGGTG
TCGACAGCCCGAGAAAACCGCGACATGACGTGTCTCAACTTCGCTCTCAACTGGCTCTTTCACTTTGGGCGCGCC
CACCCTCAACTCGTGCAAAACCTGCAGCCTGACAATCAGATGGGCTTTGGCAAAGAAAGTCTAACCTTTCTGCGC
GTCAAGGCAAAGGAAACTGGCATGTGGAGTCTATGGAGCTCAGTGCTTCTCAGCGAGGCCAAACTAGCTCTTGTC
CACGGCGACTCTTTGGCGTCGTGTACCGAGAATATGGCGCGCAGCTCCCAGCTCATTGTGGACAAGAACATGGCG
AGCATGATGGGCGCTCAATTGTCCCTCAAAGCGGCTTTGTGGAACCGAGCTGGCTTGACCCAGCTGTCGACGCTG
ACCTCTGAAGTCTTCCTGCGCTGTTATGCGACGAATTGCGTCTTTGATGAGGAGTTGAAGCATGTCTGTCGCATC
TCAATTGCCCTATGTGAGCGTGGGCGATTTGATCAAGCGCTCGAGAGGCTCCAGAATTTGGATCAAAATTCACTT
CGTTCATGGAAGTCGAACCAGTACTGGCACAAGTATAAAGCCATTGTCAAGCTAAAAAGAAATTTGCATCACCAC
AATCTCGACGGCGCCGGAGAGATTTTGGAACAGCTGCTGCAGTCCAAAGACGACGACTTTGAGCCCGACTTGACC
TTTTTCATTGATTCACTCAATATTGACTACCTATCGCGGCGAGGCGATCTCGTATCCGCTTTTCTGTATCTGGAC
CGCTTGAGGCACAAATATGACGACGATAGCAAGGATATTGCGCTCCGAATCAAACTGCTGCTCCTCAAGGTGTCG
CTCTTCCAACGGTGCGGCCGGGTGCAAAGAGCCTTCTCAACCGTAATCCGGGCAGCAAGAATGGCCAAGCGAGCG
CGTCAGGGCTACTGTCTTTTGCAAGCTTTGATGGCACTAGCCAACATACTCGTCTCCATGGCAGAGTTTGAGGCA
GCACTCAACGTGGTGCACAGCATAATGCCTCATGCATACGAATGCGAGTCATGGGCCATGACGGCGCAAATTTAC
GGCTTGGAAGCAGATGCATTCATGGGCATCGCCGGGTCCATGGAAATCAAATCGAGGGGGCGCAATCGTTGCCTC
AAGCGCGCGTTGGCGGCTGTACAAAAGGCTTATGAGCAATATTCATGGATTGAAGAGTCGCAGCGGAAGTGCGAG
ATGATGGCCAAGAAGGCGGTGATTATGAAGCTGGCGGGCGAGGTGATGCTGGCAGCTGACTATGCGGCAGCAAGC
GTTGAGCTGCGAACAAAAGCTAAGGCCTTGAGCTTGGTCAAGGTATAA
Transcript >OphauG2|7281
ATGGCTCGCCATGTCAGCCCTTCCAATATTGGCCTGCTCATCCTAGTGGAGCTATACGCAGACGGTGCCATCTTG
GGCAACGCCGTCCTGCCTGTTCTGTCCTTTCTCGCCTCGCATATACTAACCGACATGACGCCGAGCCATGGCCCT
GCATCCGCCAGAGCCTCACGCTGGAACAAGACGCAAAGCATCGTCAACCTCATTGTCAGCATCAAGAGTTTTGAG
GAGCTTCTTGGGAGCTATGCCTTCATCATGGGCATGCCTGGAAGGAGGCTTTGGGACGAGTTCCTCCACAAGCTG
TGGGCCATTGACTCTCTCAATGCCCTACATGAGTTTTTCGAGAGATTATTACTGCTGCAACAGGCGGCTCATGGG
ACTTTGCCTTCGGGCAACAATAGTCATCATCAAGCCGCCAACAGGGTCCGGCTTTCCTACAACTCTCCATTTGGA
GTCTTTGTCCGCAAAGCATGTCTCGAGTTCAAGAGACTCCACTTCCACGAATGCGCCGACTTGTGGAAGGACCTT
GTTCGATATCGCCAACCCACCGCGCAGTATATCCGACGCAGAAACCACAGCTTTGCTCCCCTGAGCTTCGACAGC
GTCTTGCTGCACAGCGATGCCGAGTGGGGGCACGATGCCACGTCTGCCGTGGCCAAAGTCGCCTATGGTGGCATG
CTTGTTGGGCCCGGCATTGGTCAACAGCGTGGCAGAATCGCCGCCAGCACCGATGAAATTGAGTGTTTGCTCGAC
TTTCAAGTGGAACGGATGCAAAAATTCGGCAGCAGAGTGCCTGTCTCGCTTCGCCACAAATTTGGCCAGCTGCTC
CATGATAGCTACCTAGTCCCAAGCGTGACACACTATCTCAGTTATCTCGATGCTTGGCGAGCAGGCGACTATACC
ACGTCGTTTGACCTGCTCCACCGTTATTTCGATTACACAATGCAATACCGCGATCGACTCTTCTACCAGTATGCA
CTCATGAACCTGGCTGTCTTGCAAGCAGACTTTGGCTGCCACAAAGAAGCCGTGTCAGCCATGCTTGAGACGGTG
TCGACAGCCCGAGAAAACCGCGACATGACGTGTCTCAACTTCGCTCTCAACTGGCTCTTTCACTTTGGGCGCGCC
CACCCTCAACTCGTGCAAAACCTGCAGCCTGACAATCAGATGGGCTTTGGCAAAGAAAGTCTAACCTTTCTGCGC
GTCAAGGCAAAGGAAACTGGCATGTGGAGTCTATGGAGCTCAGTGCTTCTCAGCGAGGCCAAACTAGCTCTTGTC
CACGGCGACTCTTTGGCGTCGTGTACCGAGAATATGGCGCGCAGCTCCCAGCTCATTGTGGACAAGAACATGGCG
AGCATGATGGGCGCTCAATTGTCCCTCAAAGCGGCTTTGTGGAACCGAGCTGGCTTGACCCAGCTGTCGACGCTG
ACCTCTGAAGTCTTCCTGCGCTGTTATGCGACGAATTGCGTCTTTGATGAGGAGTTGAAGCATGTCTGTCGCATC
TCAATTGCCCTATGTGAGCGTGGGCGATTTGATCAAGCGCTCGAGAGGCTCCAGAATTTGGATCAAAATTCACTT
CGTTCATGGAAGTCGAACCAGTACTGGCACAAGTATAAAGCCATTGTCAAGCTAAAAAGAAATTTGCATCACCAC
AATCTCGACGGCGCCGGAGAGATTTTGGAACAGCTGCTGCAGTCCAAAGACGACGACTTTGAGCCCGACTTGACC
TTTTTCATTGATTCACTCAATATTGACTACCTATCGCGGCGAGGCGATCTCGTATCCGCTTTTCTGTATCTGGAC
CGCTTGAGGCACAAATATGACGACGATAGCAAGGATATTGCGCTCCGAATCAAACTGCTGCTCCTCAAGGTGTCG
CTCTTCCAACGGTGCGGCCGGGTGCAAAGAGCCTTCTCAACCGTAATCCGGGCAGCAAGAATGGCCAAGCGAGCG
CGTCAGGGCTACTGTCTTTTGCAAGCTTTGATGGCACTAGCCAACATACTCGTCTCCATGGCAGAGTTTGAGGCA
GCACTCAACGTGGTGCACAGCATAATGCCTCATGCATACGAATGCGAGTCATGGGCCATGACGGCGCAAATTTAC
GGCTTGGAAGCAGATGCATTCATGGGCATCGCCGGGTCCATGGAAATCAAATCGAGGGGGCGCAATCGTTGCCTC
AAGCGCGCGTTGGCGGCTGTACAAAAGGCTTATGAGCAATATTCATGGATTGAAGAGTCGCAGCGGAAGTGCGAG
ATGATGGCCAAGAAGGCGGTGATTATGAAGCTGGCGGGCGAGGTGATGCTGGCAGCTGACTATGCGGCAGCAAGC
GTTGAGCTGCGAACAAAAGCTAAGGCCTTGAGCTTGGTCAAGGTATAA
Gene >OphauG2|7281
ATGGCTCGCCATGTCAGCCCTTCCAATATTGGCCTGCTCATCCTAGTGGAGCTATACGCAGACGGTGCCATCTTG
GGCAACGCCGTCCTGCCTGTTCTGTCCTTTCTCGCCTCGCATATACTAACCGACATGACGCCGAGCCATGGCCCT
GCATCCGCCAGAGCCTCACGCTGGAACAAGACGCAAAGCATCGTCAACCTCATTGTCAGCATCAAGAGTTTTGAG
GAGCTTCTTGGGAGCTATGCCTTCATCATGGGCATGCCTGGAAGGAGGCTTTGGGACGAGTTCCTCCACAAGCTG
TGGGCCATTGACTCTCTCAATGCCCTACATGAGTTTTTCGAGAGATTATTACTGCTGCAACAGGCGGCTCATGGG
ACTTTGCCTTCGGGCAACAATAGTCATCATCAAGCCGCCAACAGGGTCCGGCTTTCCTACAACTCTCCATTTGGA
GTCTTTGTCCGCAAAGCATGTCTCGAGTTCAAGAGACTCCACTTCCACGAATGCGCCGACTTGTGGAAGGACCTT
GTTCGATATCGCCAACCCACCGCGCAGTATATCCGACGCAGAAACCACAGCTTTGCTCCCCTGAGCTTCGACAGC
GTCTTGCTGCACAGCGATGCCGAGTGGGGGCACGATGCCACGTCTGCCGTGGCCAAAGTCGCCTATGGTGGCATG
CTTGTTGGGCCCGGCATTGGTCAACAGCGTGGCAGAATCGCCGCCAGCACCGATGAAATTGAGTGTTTGCTCGAC
TTTCAAGTGGAACGGATGCAAAGTCAGTGCCGCAAGGCCACACCCACACCGTCATGGTCCCTTGGCAATTTGCTG
ACTGCCGGCTGTTTTTAGAATTCGGCAGCAGAGTGCCTGTCTCGCTTCGCCACAAATTTGGCCAGCTGCTCCATG
ATAGCTACCTAGTCCCAAGCGTGACACACTATCTCAGGTTGGAAGCACCATGTTGTCCCATTGGCCGTCTTTTTT
TTTTTCCTTCTTTCTTTTTCTTCGTTTTTTTTTTTTTTTTTGGTTTACCTGCTGACTGACGCCTACGGCCTTTGC
TTAGTTATCTCGATGCTTGGCGAGCAGGCGACTATACCACGTCGTTTGACCTGCTCCACCGTTATTTCGATTACA
CAATGCAATACCGCGATCGACTCTTCTACCAGTATGCACTCATGAACCTGGCTGTCTTGCAAGCAGACTTTGGCT
GCCACAAAGAAGCCGTGTCAGCCATGCTTGAGACGGTGTCGACAGCCCGAGAAAACCGCGACATGACGTGTCTCA
ACTTCGCTCTCAACTGGCTCTTTCACTTTGGGCGCGCCCACCCTCAACTCGTGCAAAACCTGCAGCCTGACAATC
AGATGGGCTTTGGCAAAGAAAGTCTAACCTTTCTGCGCGTCAAGGCAAAGGAAACTGGCATGTGGAGTCTATGGA
GCTCAGTGCTTCTCAGCGAGGCCAAACTAGCTCTTGTCCACGGCGACTCTTTGGCGTCGTGTACCGAGAATATGG
CGCGCAGCTCCCAGCTCATTGTGGACAAGAACATGGCGAGCATGATGGGCGCTCAATTGTCCCTCAAAGCGGCTT
TGTGGAACCGAGCTGGCTTGACCCAGCTGTCGACGCTGACCTCTGAAGTCTTCCTGCGCTGTTATGCGACGAATT
GCGTCTTTGATGAGGAGTTGAAGCATGTCTGTCGCATCTCAATTGCCCTATGTGAGCGTGGGCGATTTGATCAAG
CGCTCGAGAGGCTCCAGAATTTGGATCAAAATTCACTTCGTTCATGGAAGTCGAACCAGTACTGGCACAAGTATA
AAGCCATTGTCAAGCTAAAAAGAAATTTGCATCACCACAATCTCGACGGCGCCGGAGAGATTTTGGAACAGCTGC
TGCAGTCCAAAGACGACGACTTTGAGCCCGACTTGACCTTTTTCATTGATTCACTCAATATTGACTACCTATCGC
GGCGAGGCGATCTCGTATCCGCTTTTCTGTATCTGGACCGCTTGAGGCACAAATATGACGACGATAGCAAGGATA
TTGCGCTCCGAATCAAACTGCTGCTCCTCAAGGTGTCGCTCTTCCAACGGTGCGGCCGGGTGCAAAGAGCCTTCT
CAACCGTAATCCGGGCAGCAAGAATGGCCAAGCGAGCGCGTCAGGGCTACTGTCTTTTGCAAGCTTTGATGGCAC
TAGCCAACATACTCGTCTCCATGGCAGAGTTTGAGGCAGCACTCAACGTGGTGCACAGCATAATGCCTCATGCAT
ACGAATGCGAGTCATGGGCCATGACGGCGCAAATTTACGGCTTGGAAGCAGATGCATTCATGGGCATCGCCGGGT
CCATGGAAATCAAATCGAGGGGGCGCAATCGTTGCCTCAAGCGCGCGTTGGCGGCTGTACAAAAGGCTTATGAGC
AATATTCATGGATTGAAGAGTCGCAGCGGAAGTGCGAGATGATGGCCAAGAAGGCGGTGATTATGAAGCTGGCGG
GCGAGGTGATGCTGGCAGCTGACTATGCGGCAGCAAGCGTTGAGCTGCGAACAAAAGCTAAGGCCTTGAGCTTGG
TCAAGGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail