Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7266
Gene name
LocationContig_828:6162..8480
Strand+
Gene length (bp)2318
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 2.9E-31 64 265
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 3.3E-06 388 500

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53626|E13B_TRIHA Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum GN=bgn13.1 PE=1 SV=1 14 646 0.0E+00
sp|P49426|EXG1_COCCA Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum GN=EXG1 PE=1 SV=1 25 619 2.0E-58
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 352 646 4.0E-45
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 14 320 1.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7266
MLALLAVGCAFAWPSSHHGSRRSQGFWYAAMDHSGPGRGYAPDLDNDYSYQVYQAVDPGHGDGIQAAIDSDKGGK
RHGRWLASQPRVVYIPPGTYEIQSTIRLKTDTILMGDATDPPILKAASTFSGDQILVSGQDPSTGVLGEESFAVG
LKNLVLDTTQMAPEKDFTALWWGVGQGAQLQNVRISMAASRDGRGHSGIRLGRGSTLGVSDVRLERGLNGIWHDS
HQQAAYKSIYFYQNTVGLLMSGGSTMTVMASTFDSCGVAIRNTQTAPWIALVDSTSINSGVSLVSSGSPSFVIEN
FDKDTDSDIAQVSGKTVLGGQRHVDSFSYANTVGRSPVYGPTTWSNKRPEALAPGGRFPALAAPNYADKTADDFI
NVKDPSRNGGHKILGDNSRDESQALNQVLELAAKLDKIAYFPFGKYRVDSTLVIPRGSRIVGEAWATITGSGGFF
KDESKPRAVVSVGRPGEVGVAQIQDMRFTVSEVLPGAIVVQFNMAGASPGDVALWNSLVTVGGTRGAPGLTDACT
DASNPCKGAFLGMHMAKSSSAYVENTWTWVSDHIAEAFGGGTSIAAKGGVLVESTRATWLHALGSEHWWLYQLNL
RQAANVFVSMLQAETNYEQGENARVAVPAPWTADEANWGDPGFEWCL*
Coding >OphauG2|7266
ATGTTGGCTCTTTTGGCAGTGGGCTGTGCCTTTGCATGGCCCAGCAGCCATCATGGCTCGAGGCGCAGCCAGGGC
TTTTGGTATGCGGCCATGGACCACTCGGGGCCTGGGCGCGGATATGCCCCAGACCTCGACAATGACTACTCCTAC
CAGGTCTACCAAGCCGTCGACCCGGGACACGGCGACGGCATCCAGGCCGCAATCGACAGCGACAAGGGCGGCAAG
CGCCATGGCAGGTGGCTGGCATCGCAGCCCAGAGTCGTCTACATCCCCCCTGGCACATATGAAATTCAAAGCACC
ATTCGCCTCAAGACGGACACGATTCTCATGGGCGATGCAACAGATCCTCCCATTCTCAAGGCTGCCTCGACCTTT
TCTGGCGACCAGATTCTCGTGTCTGGCCAGGATCCCAGCACTGGTGTGCTTGGCGAGGAGTCGTTTGCCGTGGGG
CTAAAGAATCTAGTCCTTGACACGACGCAAATGGCACCAGAAAAGGACTTTACGGCGCTGTGGTGGGGAGTCGGC
CAAGGGGCCCAGCTTCAAAACGTTAGAATCTCCATGGCTGCATCCAGAGACGGGCGAGGCCACAGCGGCATCCGT
CTTGGGCGCGGCTCTACGCTGGGCGTCTCCGACGTGCGTCTTGAGCGGGGGCTGAACGGCATCTGGCACGACAGC
CACCAGCAGGCAGCGTACAAGAGCATCTACTTTTACCAAAACACGGTTGGCCTGCTCATGAGCGGAGGCAGCACC
ATGACGGTCATGGCGTCCACCTTTGACTCGTGCGGCGTGGCCATTCGCAATACGCAAACGGCGCCTTGGATAGCG
CTTGTTGATTCCACGTCGATCAACTCGGGCGTGTCGCTGGTCAGCAGCGGCTCGCCGTCGTTTGTCATTGAAAAC
TTTGACAAGGACACCGACTCGGACATTGCTCAAGTGTCGGGCAAGACGGTGCTGGGGGGCCAGAGACACGTCGAC
AGCTTCAGCTATGCCAACACGGTGGGCCGCAGTCCCGTCTACGGGCCGACGACGTGGTCTAACAAGCGGCCTGAA
GCACTGGCCCCGGGGGGGAGGTTCCCGGCCCTCGCTGCCCCCAACTACGCTGACAAGACGGCAGACGACTTTATC
AATGTCAAGGACCCCTCTCGGAATGGCGGGCACAAGATCTTGGGGGACAATAGCCGCGACGAGTCTCAAGCTCTG
AACCAGGTGCTCGAGCTGGCTGCCAAGCTGGACAAGATTGCCTATTTCCCGTTTGGAAAGTACCGCGTCGACTCG
ACGCTCGTGATTCCTCGCGGGTCGCGCATCGTGGGCGAGGCATGGGCGACAATTACCGGCAGCGGCGGGTTCTTC
AAGGACGAGTCCAAGCCCCGGGCTGTGGTGTCTGTGGGCCGGCCAGGAGAGGTTGGCGTGGCGCAGATTCAAGAT
ATGCGCTTCACCGTGTCCGAGGTGCTCCCGGGGGCCATTGTGGTGCAGTTCAACATGGCTGGGGCATCGCCCGGC
GACGTGGCTCTCTGGAACTCGCTGGTGACAGTGGGCGGGACTCGCGGGGCGCCCGGGCTAACCGACGCCTGCACC
GACGCCAGCAACCCATGCAAAGGAGCCTTTCTCGGAATGCACATGGCCAAGTCGTCGAGCGCCTATGTGGAAAAC
ACGTGGACCTGGGTCTCGGACCACATCGCCGAGGCCTTTGGCGGCGGGACCAGCATCGCAGCAAAGGGCGGCGTC
TTGGTCGAGTCGACACGAGCCACCTGGCTCCACGCCCTCGGCAGCGAGCACTGGTGGCTGTACCAGCTCAACCTG
CGCCAGGCGGCCAATGTCTTTGTGTCGATGCTACAGGCCGAGACCAACTATGAGCAGGGCGAGAATGCGCGCGTG
GCGGTGCCGGCGCCGTGGACGGCGGACGAGGCCAACTGGGGCGACCCAGGCTTTGAGTGGTGCCTTTGA
Transcript >OphauG2|7266
ATGTTGGCTCTTTTGGCAGTGGGCTGTGCCTTTGCATGGCCCAGCAGCCATCATGGCTCGAGGCGCAGCCAGGGC
TTTTGGTATGCGGCCATGGACCACTCGGGGCCTGGGCGCGGATATGCCCCAGACCTCGACAATGACTACTCCTAC
CAGGTCTACCAAGCCGTCGACCCGGGACACGGCGACGGCATCCAGGCCGCAATCGACAGCGACAAGGGCGGCAAG
CGCCATGGCAGGTGGCTGGCATCGCAGCCCAGAGTCGTCTACATCCCCCCTGGCACATATGAAATTCAAAGCACC
ATTCGCCTCAAGACGGACACGATTCTCATGGGCGATGCAACAGATCCTCCCATTCTCAAGGCTGCCTCGACCTTT
TCTGGCGACCAGATTCTCGTGTCTGGCCAGGATCCCAGCACTGGTGTGCTTGGCGAGGAGTCGTTTGCCGTGGGG
CTAAAGAATCTAGTCCTTGACACGACGCAAATGGCACCAGAAAAGGACTTTACGGCGCTGTGGTGGGGAGTCGGC
CAAGGGGCCCAGCTTCAAAACGTTAGAATCTCCATGGCTGCATCCAGAGACGGGCGAGGCCACAGCGGCATCCGT
CTTGGGCGCGGCTCTACGCTGGGCGTCTCCGACGTGCGTCTTGAGCGGGGGCTGAACGGCATCTGGCACGACAGC
CACCAGCAGGCAGCGTACAAGAGCATCTACTTTTACCAAAACACGGTTGGCCTGCTCATGAGCGGAGGCAGCACC
ATGACGGTCATGGCGTCCACCTTTGACTCGTGCGGCGTGGCCATTCGCAATACGCAAACGGCGCCTTGGATAGCG
CTTGTTGATTCCACGTCGATCAACTCGGGCGTGTCGCTGGTCAGCAGCGGCTCGCCGTCGTTTGTCATTGAAAAC
TTTGACAAGGACACCGACTCGGACATTGCTCAAGTGTCGGGCAAGACGGTGCTGGGGGGCCAGAGACACGTCGAC
AGCTTCAGCTATGCCAACACGGTGGGCCGCAGTCCCGTCTACGGGCCGACGACGTGGTCTAACAAGCGGCCTGAA
GCACTGGCCCCGGGGGGGAGGTTCCCGGCCCTCGCTGCCCCCAACTACGCTGACAAGACGGCAGACGACTTTATC
AATGTCAAGGACCCCTCTCGGAATGGCGGGCACAAGATCTTGGGGGACAATAGCCGCGACGAGTCTCAAGCTCTG
AACCAGGTGCTCGAGCTGGCTGCCAAGCTGGACAAGATTGCCTATTTCCCGTTTGGAAAGTACCGCGTCGACTCG
ACGCTCGTGATTCCTCGCGGGTCGCGCATCGTGGGCGAGGCATGGGCGACAATTACCGGCAGCGGCGGGTTCTTC
AAGGACGAGTCCAAGCCCCGGGCTGTGGTGTCTGTGGGCCGGCCAGGAGAGGTTGGCGTGGCGCAGATTCAAGAT
ATGCGCTTCACCGTGTCCGAGGTGCTCCCGGGGGCCATTGTGGTGCAGTTCAACATGGCTGGGGCATCGCCCGGC
GACGTGGCTCTCTGGAACTCGCTGGTGACAGTGGGCGGGACTCGCGGGGCGCCCGGGCTAACCGACGCCTGCACC
GACGCCAGCAACCCATGCAAAGGAGCCTTTCTCGGAATGCACATGGCCAAGTCGTCGAGCGCCTATGTGGAAAAC
ACGTGGACCTGGGTCTCGGACCACATCGCCGAGGCCTTTGGCGGCGGGACCAGCATCGCAGCAAAGGGCGGCGTC
TTGGTCGAGTCGACACGAGCCACCTGGCTCCACGCCCTCGGCAGCGAGCACTGGTGGCTGTACCAGCTCAACCTG
CGCCAGGCGGCCAATGTCTTTGTGTCGATGCTACAGGCCGAGACCAACTATGAGCAGGGCGAGAATGCGCGCGTG
GCGGTGCCGGCGCCGTGGACGGCGGACGAGGCCAACTGGGGCGACCCAGGCTTTGAGTGGTGCCTTTGA
Gene >OphauG2|7266
ATGTTGGCTCTTTTGGCAGTGGGCTGTGCCTTTGCATGGCCCAGCAGCCATCATGGCTCGAGGCGCAGCCAGGGC
TTTTGGTATGCGGCCATGGACCACTCGGGGCCTGGGCGCGGATATGCCCCAGACCTCGACAATGACTACTCCTAC
CAGGTCTACCAAGCCGTCGACCCGGGACACGGCGACGGCATCCAGGCCGCAATCGACAGCGACAAGGGCGGCAAG
CGCCATGGCAGGTGGCTGGCATCGCAGCCCAGAGTAGGCTTCAAATCCATGCAGAAGCCTTCCTCTAGCACAAAG
GCTCATGCTGCCTCCAGGTCGTCTACATCCCCCCTGGCACATATGAAATTCAAAGCACCATTCGCCTCAAGACGG
ACACGATTCTCATGGGCGATGCAACAGATGTATGAAGCCAGCCAGTCTTGTTGTTGCCTCGCAGCTGCTTATGCT
TGGCGTGTGTGTGCCTTAGCCTCCCATTCTCAAGGCTGCCTCGACCTTTTCTGGCGACCAGATTCTCGTGTCTGG
TAAGGCGGCCATGGCTGGATCCTGCTCACCACTTGCTGACCATGTATGCCACGATAGGCCAGGATCCCAGCACTG
GTGTGCTTGGCGAGGAGTCGTTTGCCGTGGGGCTAAAGAATCTAGTCCTTGACACGACGCAAATGGCACCAGGTA
AAAAAAAGGCTTCTTACAACTGCTGGGTGGCCAAGGGCTGTTTTTGCTGAGAGGTGGGCAGAAAAGGACTTTACG
GCGCTGTGGTGGGGAGTCGGCCAAGGGGCCCAGCTTCAAAACGTTAGAATCTCCATGGCTGCATCCAGAGACGGG
CGAGGCCACAGCGGCATCCGTCTTGGGCGCGGCTCTACGCTGGGCGTCTCCGACGTGCGTCTTGAGCGGGGGCTG
AACGGCATCTGGCACGACAGCCACCAGCAGGCAGCGTACAAGAGCATCTACTTTTACCAAAACACGGTTGGCCTG
CTCATGAGCGGAGGCAGCACCATGACGGTCATGGCGTCCACCTTTGACTCGTGCGGCGTGGCCATTCGCAATACG
CAAACGGCGCCTTGGATAGCGCTTGTTGATTCCACGTCGATCAACTCGGGCGTGTCGCTGGTCAGCAGCGGCTCG
CCGTCGTTTGTCATTGAAAACTTTGACAAGGACACCGACTCGGACATTGCTCAAGTGTCGGGCAAGACGGTGCTG
GGGGGCCAGAGACACGTCGACAGCTTCAGCTATGCCAACACGGTGGGCCGCAGTCCCGTCTACGGGCCGACGACG
TGGTCTAACAAGCGGCCTGAAGCACTGGCCCCGGGGGGGAGGTTCCCGGCCCTCGCTGCCCCCAACTACGCTGAC
AAGACGGCAGACGACTTTATCAATGTCAAGGACCCCTCTCGGAATGGCGGGCACAAGATCTTGGGGGACAATAGC
CGCGACGAGTCTCAAGCTCTGAACCAGGTGCTCGAGCTGGCTGCCAAGCTGGACAAGATTGCCTATTTCCCGTTT
GGAAAGTACCGCGTCGACTCGACGCTCGTGATTCCTCGCGGGTCGCGCATCGTGGGCGAGGCATGGGCGACAATT
ACCGGCAGCGGCGGGTTCTTCAAGGACGAGTCCAAGCCCCGGGCTGTGGTGTCTGTGGGCCGGCCAGGAGAGGTT
GGCGTGGCGCAGATTCAAGATATGCGCTTCACCGTGTCCGAGGTGCTCCCGGGGGCCATTGTGGTGCAGTTCAAC
ATGGCTGGGGCATCGCCCGGCGACGTGGCTCTCTGGAACTCGCTGGTGACAGTGGGCGGGACTCGCGGGGCGCCC
GGGCTAACCGACGCCTGCACCGACGCCAGCAACCCATGCAAAGGAGCCTTTCTCGGAATGCACATGGCCAAGTCG
TCGAGCGCCTATGTGGAAAACACGTGGACCTGGGTCTCGGACCACATCGCCGAGGCCTTTGGCGGCGGGACCAGC
ATCGCAGCAAAGGGCGGCGTCTTGGTCGAGTCGACACGAGCCACCTGGCTCCACGCCCTCGGCAGCGAGCACTGG
TGGCTGTACCAGCTCAACCTGCGCCAGGCGGCCAATGTCTTTGTGTCGATGCTACAGGCCGAGACCAACTATGAG
CAGGGCGAGAATGCGCGCGTGGCGGTGCCGGCGCCGTGGACGGCGGACGAGGCCAACTGGGGCGACCCAGGCTTT
GAGTGGTGCCGTGGCGGCAGCAGCAGGCGGTGCCGGATGGGGTTTGGCAACTTTATCAATGGCGGACGAGACATT
TACACGTACAATTCAGCGGCGTGGGCCTTTTTCAGCGGGCCGGGACGCCAGGGCTGTGGGCAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail