Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7256
Gene name
LocationContig_826:3389..3980
Strand-
Gene length (bp)591
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01176 eIF-1a Translation initiation factor 1A / IF-1 5.1E-22 32 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BMJ3|IF1AX_MOUSE Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus GN=Eif1ax PE=2 SV=3 1 131 7.0E-74
sp|Q5RA42|IF1AX_PONAB Eukaryotic translation initiation factor 1A, X-chromosomal OS=Pongo abelii GN=EIF1AX PE=2 SV=3 1 131 7.0E-74
sp|P47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens GN=EIF1AX PE=1 SV=2 1 131 7.0E-74
sp|Q6GVM3|IF1AY_PANTR Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Pan troglodytes GN=EIF1AY PE=2 SV=3 1 131 1.0E-73
sp|Q6VV72|IF1A_RAT Eukaryotic translation initiation factor 1A OS=Rattus norvegicus GN=Eif1a PE=2 SV=3 1 131 2.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BMJ3|IF1AX_MOUSE Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus GN=Eif1ax PE=2 SV=3 1 131 7.0E-74
sp|Q5RA42|IF1AX_PONAB Eukaryotic translation initiation factor 1A, X-chromosomal OS=Pongo abelii GN=EIF1AX PE=2 SV=3 1 131 7.0E-74
sp|P47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens GN=EIF1AX PE=1 SV=2 1 131 7.0E-74
sp|Q6GVM3|IF1AY_PANTR Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Pan troglodytes GN=EIF1AY PE=2 SV=3 1 131 1.0E-73
sp|Q6VV72|IF1A_RAT Eukaryotic translation initiation factor 1A OS=Rattus norvegicus GN=Eif1a PE=2 SV=3 1 131 2.0E-73
sp|Q60872|IF1A_MOUSE Eukaryotic translation initiation factor 1A OS=Mus musculus GN=Eif1a PE=2 SV=3 1 131 2.0E-73
sp|O14602|IF1AY_HUMAN Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Homo sapiens GN=EIF1AY PE=1 SV=4 1 131 2.0E-73
sp|P47814|IF1A_RABIT Eukaryotic translation initiation factor 1A OS=Oryctolagus cuniculus GN=EIF1A PE=1 SV=2 1 131 2.0E-71
sp|P55877|IF1A_SCHPO Eukaryotic translation initiation factor 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif11 PE=2 SV=2 1 138 5.0E-69
sp|Q54YJ6|IF1A_DICDI Eukaryotic translation initiation factor 1A OS=Dictyostelium discoideum GN=eif1a PE=3 SV=1 1 142 7.0E-62
sp|P56331|IF1A_ONOVI Eukaryotic translation initiation factor 1A OS=Onobrychis viciifolia PE=2 SV=2 1 117 4.0E-57
sp|P47815|IF1A_WHEAT Eukaryotic translation initiation factor 1A OS=Triticum aestivum PE=1 SV=2 1 128 6.0E-57
sp|P38912|IF1A_YEAST Eukaryotic translation initiation factor 1A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF11 PE=1 SV=1 18 136 1.0E-53
sp|Q8TXZ3|IF1A_METKA Translation initiation factor 1A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eIF1A PE=3 SV=1 15 113 1.0E-18
sp|C3MU29|IF1A_SULIM Translation initiation factor 1A OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=eIF1A PE=3 SV=1 24 103 5.0E-18
sp|C3N0P1|IF1A_SULIA Translation initiation factor 1A OS=Sulfolobus islandicus (strain M.16.27) GN=eIF1A PE=3 SV=1 24 103 5.0E-18
sp|C4KK84|IF1A_SULIK Translation initiation factor 1A OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=eIF1A PE=3 SV=1 24 103 5.0E-18
sp|C3MK60|IF1A_SULIL Translation initiation factor 1A OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eIF1A PE=3 SV=1 24 103 5.0E-18
sp|C3NMA0|IF1A_SULIN Translation initiation factor 1A OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=eIF1A PE=3 SV=1 24 103 5.0E-18
sp|C3N8M9|IF1A_SULIY Translation initiation factor 1A OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=eIF1A PE=3 SV=1 24 103 5.0E-18
sp|Q97W62|IF1A_SULSO Translation initiation factor 1A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eIF1A PE=3 SV=1 24 103 6.0E-18
sp|Q974Z9|IF1A_SULTO Translation initiation factor 1A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eIF1A PE=3 SV=2 24 103 1.0E-17
sp|B0R7D8|IF1A_HALS3 Translation initiation factor 1A OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eIF1A PE=3 SV=1 23 109 4.0E-17
sp|Q9HN64|IF1A1_HALSA Translation initiation factor 1A 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eIF1A1 PE=3 SV=1 23 109 4.0E-17
sp|Q5UZM2|IF1A_HALMA Translation initiation factor 1A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif1a PE=3 SV=2 19 111 7.0E-17
sp|O29481|IF1A_ARCFU Translation initiation factor 1A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eIF1A PE=3 SV=2 16 109 1.0E-16
sp|Q6L2G4|IF1A_PICTO Translation initiation factor 1A OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=eif1a PE=3 SV=1 29 111 1.0E-16
sp|Q4JA54|IF1A_SULAC Translation initiation factor 1A OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=eif1a PE=3 SV=1 17 103 1.0E-16
sp|Q3IT14|IF1A_NATPD Translation initiation factor 1A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=eif1a PE=3 SV=1 23 109 2.0E-16
sp|A2STQ8|IF1A_METLZ Translation initiation factor 1A OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=eIF1A PE=3 SV=1 15 109 4.0E-16
sp|Q18EX1|IF1A1_HALWD Translation initiation factor 1A 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif1a1 PE=3 SV=1 19 109 8.0E-16
sp|A4YEH8|IF1A_METS5 Translation initiation factor 1A OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=eIF1A PE=3 SV=1 30 103 9.0E-16
sp|B8D5N1|IF1A_DESK1 Translation initiation factor 1A OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=eIF1A PE=3 SV=1 13 111 7.0E-15
sp|Q979F7|IF1A_THEVO Translation initiation factor 1A OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eIF1A PE=3 SV=1 26 111 7.0E-15
sp|Q03590|IF1A_THEAC Translation initiation factor 1A OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=eIF1A PE=3 SV=2 26 111 8.0E-15
sp|P57676|IF1A_AERPE Translation initiation factor 1A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eIF1A PE=3 SV=1 26 112 8.0E-14
sp|Q469J2|IF1A1_METBF Translation initiation factor 1A 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eif1a1 PE=3 SV=1 29 109 9.0E-14
sp|Q8TSA3|IF1A1_METAC Translation initiation factor 1A 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eIF1A1 PE=3 SV=1 29 109 1.0E-13
sp|Q8PUJ8|IF1A2_METMA Translation initiation factor 1A 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eIF1A2 PE=3 SV=1 10 109 2.0E-13
sp|Q2NEP1|IF1A_METST Translation initiation factor 1A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=eif1a PE=3 SV=1 40 109 2.0E-13
sp|Q8PVF1|IF1A1_METMA Translation initiation factor 1A 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eIF1A1 PE=3 SV=2 7 109 3.0E-13
sp|Q12YN5|IF1A_METBU Translation initiation factor 1A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=eif1a PE=3 SV=1 29 109 3.0E-13
sp|Q8TR33|IF1A2_METAC Translation initiation factor 1A 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eIF1A2 PE=3 SV=1 10 109 6.0E-13
sp|O27085|IF1A_METTH Translation initiation factor 1A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eIF1A PE=3 SV=1 40 109 9.0E-13
sp|Q8TR31|IF1A3_METAC Translation initiation factor 1A 3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eIF1A3 PE=3 SV=1 5 109 1.0E-12
sp|Q18JF4|IF1A2_HALWD Translation initiation factor 1A 2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif1a2 PE=3 SV=1 23 109 2.0E-12
sp|Q9HP87|IF1A2_HALSA Translation initiation factor 1A 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eIF1A2 PE=3 SV=2 23 109 8.0E-12
sp|Q469I9|IF1A2_METBF Translation initiation factor 1A 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eif1a2 PE=3 SV=1 29 109 1.0E-11
sp|A6UUK8|IF1A_META3 Translation initiation factor 1A OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eIF1A PE=3 SV=1 24 109 2.0E-11
sp|Q57887|IF1A_METJA Translation initiation factor 1A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eIF1A PE=1 SV=1 23 111 6.0E-11
sp|A4FYM5|IF1A_METM5 Translation initiation factor 1A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eIF1A PE=3 SV=1 14 109 1.0E-10
sp|A6VJQ7|IF1A_METM7 Translation initiation factor 1A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eIF1A PE=3 SV=1 24 109 5.0E-10
sp|A9A6C2|IF1A_METM6 Translation initiation factor 1A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eIF1A PE=3 SV=1 24 109 5.0E-10
sp|Q6LZM1|IF1A_METMP Translation initiation factor 1A OS=Methanococcus maripaludis (strain S2 / LL) GN=eif1a PE=3 SV=1 24 109 6.0E-10
sp|Q9V138|IF1A_PYRAB Translation initiation factor 1A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eIF1A PE=1 SV=2 17 109 4.0E-09
sp|Q8U0K5|IF1A_PYRFU Translation initiation factor 1A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eIF1A PE=3 SV=2 26 109 7.0E-09
sp|O59280|IF1A_PYRHO Translation initiation factor 1A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eIF1A PE=3 SV=2 26 109 7.0E-09
sp|Q5JH78|IF1A_THEKO Translation initiation factor 1A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif1a PE=3 SV=1 15 111 3.0E-08
sp|Q8ZXV9|IF1A_PYRAE Translation initiation factor 1A OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=eIF1A PE=3 SV=2 25 107 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0006413 translational initiation Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0045182 translation regulator activity No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4925
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7256 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5035
Ophiocordyceps camponoti-floridani Ophcf2|06173
Ophiocordyceps camponoti-rufipedis Ophun1|523
Ophiocordyceps kimflemingae Ophio5|4472
Ophiocordyceps subramaniannii Hirsu2|1600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7256
MPKNKGKGGKNRRRGTKENDDQRRELTFKEDGQEYAQVIKMLGNGRLEAMCFDGSKRLANIRGKMRKKVWINQGD
IILLSLRDFQDNKGDVILKYTADEARTLKSYGELPEHAKINETDTFGQGEDGEVGFEFGDADSDDSDEAGKKEVD
IDDI*
Coding >OphauG2|7256
ATGCCCAAGAATAAAGGCAAGGGCGGCAAAAACCGCAGACGAGGCACCAAGGAAAATGACGACCAGCGCCGAGAA
CTCACCTTCAAGGAAGACGGCCAAGAATATGCCCAGGTCATCAAGATGCTAGGCAACGGTCGCCTCGAGGCCATG
TGCTTCGACGGCAGCAAGCGTTTAGCTAATATTCGCGGCAAGATGCGTAAAAAGGTCTGGATCAATCAAGGCGAC
ATCATCCTGCTATCTCTGCGTGACTTTCAAGACAACAAGGGCGACGTCATCCTCAAGTACACAGCAGATGAGGCT
CGCACCCTGAAATCTTACGGAGAATTGCCCGAACACGCAAAAATCAACGAGACGGATACCTTTGGTCAGGGAGAA
GACGGCGAGGTTGGTTTCGAGTTTGGCGATGCAGACTCGGACGATTCCGATGAGGCTGGCAAGAAGGAGGTCGAC
ATTGACGACATCTAA
Transcript >OphauG2|7256
ATGCCCAAGAATAAAGGCAAGGGCGGCAAAAACCGCAGACGAGGCACCAAGGAAAATGACGACCAGCGCCGAGAA
CTCACCTTCAAGGAAGACGGCCAAGAATATGCCCAGGTCATCAAGATGCTAGGCAACGGTCGCCTCGAGGCCATG
TGCTTCGACGGCAGCAAGCGTTTAGCTAATATTCGCGGCAAGATGCGTAAAAAGGTCTGGATCAATCAAGGCGAC
ATCATCCTGCTATCTCTGCGTGACTTTCAAGACAACAAGGGCGACGTCATCCTCAAGTACACAGCAGATGAGGCT
CGCACCCTGAAATCTTACGGAGAATTGCCCGAACACGCAAAAATCAACGAGACGGATACCTTTGGTCAGGGAGAA
GACGGCGAGGTTGGTTTCGAGTTTGGCGATGCAGACTCGGACGATTCCGATGAGGCTGGCAAGAAGGAGGTCGAC
ATTGACGACATCTAA
Gene >OphauG2|7256
ATGCCCAAGAATAAAGGCAAGGTGCGTCATGACAGCCTTGACTCAAGCACTCTTGTTCAACGTTCCGGCTGACGC
GCTTCGCGCTTTCTTACAGGGCGGCAAAAACCGCAGACGAGGCACCAAGGAAAATGACGACCAGCGCCGAGAACT
CACCTTCAAGGAAGACGGCCAAGAATATGCCCAGGTCATCAAGATGCTAGGCAACGGTCGCCTCGAGGCCATGTG
CTTCGACGGCAGCAAGCGTTTAGCTAATGTGCGTGCATCTGCTTCATCATTTTATTATCGTCTAACCATGCAGCA
CTAAAGATTCGCGGCAAGATGCGTAAAAAGGTCTGGATCAATCAAGGCGACATCATCCTGCTATCTCTGCGTGAC
TTTCAAGACAACAAGGGCGACGTCATCCTCAAGTACACAGCAGATGAGGCTCGCACCCTGAAATCTTACGGAGAA
TTGCCCGAACACGCAAAAATCAACGAGACGGATACCTTTGGTCAGGGAGAAGACGGCGAGGTTGGTTTCGAGTTT
GGCGATGCAGACTCGGACGATTCCGATGAGGCTGGCAAGAAGGAGGTCGACATTGACGACATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail