Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7247
Gene name
LocationContig_822:4950..7362
Strand-
Gene length (bp)2412
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 4.3E-101 38 592
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 8.9E-13 124 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 40 673 3.0E-126
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 40 673 6.0E-126
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 31 661 3.0E-123
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 31 661 6.0E-123
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 40 661 7.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 40 673 3.0E-126
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 40 673 6.0E-126
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 31 661 3.0E-123
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 31 661 6.0E-123
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 40 661 7.0E-123
sp|O00203|AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens GN=AP3B1 PE=1 SV=3 31 661 1.0E-121
sp|Q556J8|AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum GN=ap3b-1 PE=3 SV=1 39 661 1.0E-98
sp|O13939|AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl6 PE=1 SV=1 7 746 2.0E-92
sp|P46682|AP3B_YEAST AP-3 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL6 PE=1 SV=2 1 611 6.0E-78
sp|Q759E2|AP3B_ASHGO AP-3 complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL6 PE=3 SV=2 2 661 1.0E-75
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 42 607 2.0E-52
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 39 607 2.0E-51
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 39 607 2.0E-51
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 39 607 2.0E-51
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 39 607 2.0E-51
sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 39 607 2.0E-51
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 39 608 4.0E-50
sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 60 607 2.0E-49
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 60 607 9.0E-49
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 39 608 1.0E-47
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 60 607 3.0E-47
sp|O43079|AP1B1_SCHPO AP-1 complex subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl2 PE=1 SV=1 36 592 1.0E-35
sp|O43005|AP2B_SCHPO AP-2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl1 PE=3 SV=1 46 607 1.0E-32
sp|Q9LDK9|APBLA_ARATH Beta-adaptin-like protein A OS=Arabidopsis thaliana GN=BETAA-AD PE=1 SV=1 37 529 2.0E-31
sp|Q9M2T1|AP3BA_ARATH AP3-complex subunit beta-A OS=Arabidopsis thaliana GN=AP3BA PE=2 SV=2 277 723 6.0E-29
sp|Q9Y6B7|AP4B1_HUMAN AP-4 complex subunit beta-1 OS=Homo sapiens GN=AP4B1 PE=1 SV=2 56 490 3.0E-24
sp|Q9WV76|AP4B1_MOUSE AP-4 complex subunit beta-1 OS=Mus musculus GN=Ap4b1 PE=1 SV=2 56 609 7.0E-24
sp|P36000|AP1B1_YEAST AP-1 complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL2 PE=1 SV=1 54 601 3.0E-23
sp|Q54R84|AP4B_DICDI AP-4 complex subunit beta OS=Dictyostelium discoideum GN=ap4b1 PE=3 SV=1 35 427 2.0E-19
sp|P27351|AP2B_YEAST AP-2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL1 PE=1 SV=2 289 594 8.0E-10
sp|Q9M2T1|AP3BA_ARATH AP3-complex subunit beta-A OS=Arabidopsis thaliana GN=AP3BA PE=2 SV=2 132 235 6.0E-07
sp|Q8I8U2|AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum GN=ap1g1 PE=1 SV=1 5 227 1.0E-06
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 28 246 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0030117 membrane coat Yes
GO:0032991 protein-containing complex No
GO:0070727 cellular macromolecule localization No
GO:0098796 membrane protein complex No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0015031 protein transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0071705 nitrogen compound transport No
GO:0008104 protein localization No
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2942
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7247 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4603
Ophiocordyceps camponoti-floridani Ophcf2|02894
Ophiocordyceps camponoti-rufipedis Ophun1|1802
Ophiocordyceps kimflemingae Ophio5|5841
Ophiocordyceps subramaniannii Hirsu2|4957

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7247
MESIARISGLMETARELTLDAAQATRSTRASSRLLDRTQMRKLLDSRNDREVLEGLRRVVAMMYRNHKTLPFFSS
VVKNVASPNLEIKKLVYIYLIHHAEHEPDLALLSINTIQKSLSDSNAHVRALALRTMSGIRVPVISQIVSLAVKK
GVADMSPLVRKAAALAIPKCYRLDPTQAPQLLEYLAALLGDRQYYVAGAAVCAHLEICPNEIHLIHPHYRSLVRK
IVDMDEWSQLAALRLMTIYARRCFPTRTHEPAEQSHGNATRPSRGSQASSPNPDLLLLLNSIRPLLQSRNSGVVI
AVTRCYVNVGTDDHVALAIGPLVALLRGADDIQQVALYNIVAVCLTRPGDFVKYATHFLVRATDSPGVWELKLEL
LTIIFPHSPSHVKSLILKELQHFSRGSNKALVREAVRAIGRCAQTDAATAPRCLKLLLGQITSLDGTLAAESLTV
IRHLIQQDAQNHVGTVVRLAKNLDSATDPQARATIIWLVGEFSGLNNEDNIAPDVLRILLKDFASESEAAKRQIL
LLAAKVHLHQLNRQAEALKQDDATPDTEAPDAHSHPTARLWEYILLLVRYDTSFDLRDRARMYRALLGVPQLATL
MLLAPKPAPQTPSPSEARRGFLLGSATLVLAGGGGVHGLSGYAALPEWAAPGMEPDPRLRDDQDGGRTKSGDRGV
AVERLEEATRQVGGMNGMGTKTLDDWLAEGSDKSQEEAQETESEEEDEDEEGSEEDEEESEDDEDEEEEESEDED
EGEGDGLIKS*
Coding >OphauG2|7247
ATGGAGTCGATAGCGAGGATCTCGGGTCTCATGGAGACTGCGAGAGAGCTGACTCTGGATGCCGCCCAGGCAACG
CGCTCGACTCGTGCCAGCTCGCGGCTGCTTGATCGGACGCAGATGCGGAAGCTCCTGGACAGTAGGAATGACCGC
GAGGTGCTCGAGGGTCTGCGCCGCGTGGTGGCTATGATGTACCGCAACCACAAGACGCTTCCCTTCTTCTCGTCG
GTGGTGAAGAATGTGGCGTCGCCCAATCTTGAAATCAAGAAACTCGTCTACATTTACCTCATCCACCACGCCGAG
CACGAGCCCGACCTTGCTCTCCTGTCCATCAACACGATTCAAAAGTCCCTTTCCGATTCGAATGCTCATGTCCGA
GCCCTGGCACTGAGAACAATGTCGGGCATTCGCGTCCCCGTCATTAGCCAGATTGTTTCGCTGGCTGTGAAAAAG
GGCGTGGCAGACATGAGCCCTCTTGTGCGCAAGGCCGCCGCCCTGGCTATTCCAAAGTGCTATCGGCTTGATCCC
ACCCAGGCGCCGCAACTGCTCGAGTATCTGGCCGCTCTGCTGGGCGATAGGCAGTATTACGTGGCTGGAGCTGCC
GTGTGCGCCCATCTCGAGATTTGCCCCAATGAAATCCATCTTATTCACCCGCACTACCGGTCTCTGGTTCGCAAG
ATTGTCGACATGGATGAGTGGAGCCAGTTGGCTGCCCTTCGCCTCATGACAATTTATGCCCGCCGTTGCTTTCCT
ACAAGAACACACGAGCCAGCAGAGCAGTCACATGGCAACGCGACAAGGCCAAGTAGAGGCTCTCAAGCCTCGTCG
CCCAACCCAGACTTGCTGCTTCTACTCAATTCCATCAGACCTCTGCTGCAGAGCCGCAACTCGGGCGTCGTAATT
GCTGTAACGCGGTGCTATGTCAATGTCGGCACAGATGACCATGTCGCGCTTGCTATTGGCCCTCTTGTGGCGCTG
CTCCGAGGCGCCGACGACATTCAACAAGTGGCCCTCTACAACATTGTCGCCGTTTGCCTGACACGGCCAGGTGAC
TTTGTAAAGTACGCCACGCATTTCCTCGTCCGGGCCACCGATTCGCCAGGCGTGTGGGAGCTGAAGCTGGAGCTC
CTTACCATCATCTTTCCACACAGCCCTAGCCACGTCAAAAGCCTCATCCTCAAGGAGCTCCAGCACTTTTCTCGC
GGCTCCAACAAGGCTCTGGTGCGCGAAGCAGTCCGCGCCATTGGACGCTGTGCGCAGACAGACGCGGCCACGGCG
CCTCGCTGCCTCAAGCTCCTCCTCGGCCAAATCACCAGCCTCGACGGGACGCTGGCGGCCGAGTCGCTGACTGTC
ATTCGGCACCTCATTCAGCAGGATGCACAGAATCACGTGGGCACCGTGGTGCGCTTGGCCAAGAACCTCGACTCT
GCCACGGATCCGCAGGCCAGAGCAACCATTATCTGGCTCGTAGGCGAATTTTCAGGCCTCAATAACGAGGACAAT
ATTGCGCCCGACGTGTTGCGCATCCTCCTCAAGGACTTTGCCAGCGAGTCGGAAGCCGCCAAGCGCCAAATCTTG
CTCCTGGCTGCAAAAGTTCACCTCCACCAGTTAAACCGCCAAGCCGAGGCGCTCAAGCAGGACGACGCAACCCCG
GATACAGAAGCGCCGGATGCACACAGCCACCCCACAGCCCGCCTGTGGGAATATATTCTCCTCCTTGTACGCTAC
GACACGTCGTTTGATCTTCGCGACCGCGCTCGCATGTACCGCGCGCTGCTGGGCGTGCCACAGCTGGCAACGCTC
ATGCTCCTCGCACCCAAGCCCGCCCCGCAGACACCCAGTCCGTCCGAGGCGCGGCGCGGCTTCCTTCTCGGGTCG
GCGACGCTGGTGCTCGCGGGCGGGGGCGGCGTGCATGGCCTGAGCGGCTACGCGGCGCTGCCAGAGTGGGCGGCG
CCGGGGATGGAGCCGGATCCGAGACTAAGGGATGACCAGGATGGTGGGCGGACCAAGAGCGGTGACAGAGGCGTG
GCGGTTGAGAGGCTCGAGGAAGCAACAAGGCAGGTGGGAGGGATGAATGGCATGGGTACAAAGACGCTGGATGAC
TGGTTGGCTGAGGGGAGTGACAAGAGTCAAGAGGAAGCGCAAGAGACCGAGTCGGAAGAGGAGGATGAGGATGAA
GAGGGGAGTGAGGAAGATGAAGAAGAGAGCGAGGATGATGAGGACGAGGAAGAGGAAGAAAGTGAGGACGAGGAT
GAGGGCGAAGGAGACGGATTGATCAAGTCGTGA
Transcript >OphauG2|7247
ATGGAGTCGATAGCGAGGATCTCGGGTCTCATGGAGACTGCGAGAGAGCTGACTCTGGATGCCGCCCAGGCAACG
CGCTCGACTCGTGCCAGCTCGCGGCTGCTTGATCGGACGCAGATGCGGAAGCTCCTGGACAGTAGGAATGACCGC
GAGGTGCTCGAGGGTCTGCGCCGCGTGGTGGCTATGATGTACCGCAACCACAAGACGCTTCCCTTCTTCTCGTCG
GTGGTGAAGAATGTGGCGTCGCCCAATCTTGAAATCAAGAAACTCGTCTACATTTACCTCATCCACCACGCCGAG
CACGAGCCCGACCTTGCTCTCCTGTCCATCAACACGATTCAAAAGTCCCTTTCCGATTCGAATGCTCATGTCCGA
GCCCTGGCACTGAGAACAATGTCGGGCATTCGCGTCCCCGTCATTAGCCAGATTGTTTCGCTGGCTGTGAAAAAG
GGCGTGGCAGACATGAGCCCTCTTGTGCGCAAGGCCGCCGCCCTGGCTATTCCAAAGTGCTATCGGCTTGATCCC
ACCCAGGCGCCGCAACTGCTCGAGTATCTGGCCGCTCTGCTGGGCGATAGGCAGTATTACGTGGCTGGAGCTGCC
GTGTGCGCCCATCTCGAGATTTGCCCCAATGAAATCCATCTTATTCACCCGCACTACCGGTCTCTGGTTCGCAAG
ATTGTCGACATGGATGAGTGGAGCCAGTTGGCTGCCCTTCGCCTCATGACAATTTATGCCCGCCGTTGCTTTCCT
ACAAGAACACACGAGCCAGCAGAGCAGTCACATGGCAACGCGACAAGGCCAAGTAGAGGCTCTCAAGCCTCGTCG
CCCAACCCAGACTTGCTGCTTCTACTCAATTCCATCAGACCTCTGCTGCAGAGCCGCAACTCGGGCGTCGTAATT
GCTGTAACGCGGTGCTATGTCAATGTCGGCACAGATGACCATGTCGCGCTTGCTATTGGCCCTCTTGTGGCGCTG
CTCCGAGGCGCCGACGACATTCAACAAGTGGCCCTCTACAACATTGTCGCCGTTTGCCTGACACGGCCAGGTGAC
TTTGTAAAGTACGCCACGCATTTCCTCGTCCGGGCCACCGATTCGCCAGGCGTGTGGGAGCTGAAGCTGGAGCTC
CTTACCATCATCTTTCCACACAGCCCTAGCCACGTCAAAAGCCTCATCCTCAAGGAGCTCCAGCACTTTTCTCGC
GGCTCCAACAAGGCTCTGGTGCGCGAAGCAGTCCGCGCCATTGGACGCTGTGCGCAGACAGACGCGGCCACGGCG
CCTCGCTGCCTCAAGCTCCTCCTCGGCCAAATCACCAGCCTCGACGGGACGCTGGCGGCCGAGTCGCTGACTGTC
ATTCGGCACCTCATTCAGCAGGATGCACAGAATCACGTGGGCACCGTGGTGCGCTTGGCCAAGAACCTCGACTCT
GCCACGGATCCGCAGGCCAGAGCAACCATTATCTGGCTCGTAGGCGAATTTTCAGGCCTCAATAACGAGGACAAT
ATTGCGCCCGACGTGTTGCGCATCCTCCTCAAGGACTTTGCCAGCGAGTCGGAAGCCGCCAAGCGCCAAATCTTG
CTCCTGGCTGCAAAAGTTCACCTCCACCAGTTAAACCGCCAAGCCGAGGCGCTCAAGCAGGACGACGCAACCCCG
GATACAGAAGCGCCGGATGCACACAGCCACCCCACAGCCCGCCTGTGGGAATATATTCTCCTCCTTGTACGCTAC
GACACGTCGTTTGATCTTCGCGACCGCGCTCGCATGTACCGCGCGCTGCTGGGCGTGCCACAGCTGGCAACGCTC
ATGCTCCTCGCACCCAAGCCCGCCCCGCAGACACCCAGTCCGTCCGAGGCGCGGCGCGGCTTCCTTCTCGGGTCG
GCGACGCTGGTGCTCGCGGGCGGGGGCGGCGTGCATGGCCTGAGCGGCTACGCGGCGCTGCCAGAGTGGGCGGCG
CCGGGGATGGAGCCGGATCCGAGACTAAGGGATGACCAGGATGGTGGGCGGACCAAGAGCGGTGACAGAGGCGTG
GCGGTTGAGAGGCTCGAGGAAGCAACAAGGCAGGTGGGAGGGATGAATGGCATGGGTACAAAGACGCTGGATGAC
TGGTTGGCTGAGGGGAGTGACAAGAGTCAAGAGGAAGCGCAAGAGACCGAGTCGGAAGAGGAGGATGAGGATGAA
GAGGGGAGTGAGGAAGATGAAGAAGAGAGCGAGGATGATGAGGACGAGGAAGAGGAAGAAAGTGAGGACGAGGAT
GAGGGCGAAGGAGACGGATTGATCAAGTCGTGA
Gene >OphauG2|7247
ATGGAGTCGATAGCGAGGATCTCGGGTCTCATGGAGACTGGTCAGTCCGAGGGCTTCTGCTTCAGCACCAACGTG
GGCTAACTCTGGGGGCCACAGCGAGAGAGCTGACTCTGGATGCCGCCCAGGCAACGCGCTCGACTCGTGCCAGCT
CGCGGCTGCTTGATCGGACGCAGATGCGGAAGCTCCTGGACAGTAGGAATGACCGCGAGGTGCTCGAGGGTCTGC
GCCGCGTGGTGGCTGTGAGTTCTGGGCTCCAGTCCCCGCACCCCATGCAATCGCATCGTGGTGGCTGTGGGCTGA
TGACAGGGGCAGATGATGTACCGCAACCACAAGACGCTTCCCTTCTTCTCGTCGGTGGTGAAGAATGTGGCGTCG
CCCAATCTTGAAATCAAGAAACTCGTCTACATTTACCTCATCCACCACGCCGAGCACGAGCCCGACCTTGCTCTC
CTGTCCATCAACACGATTCAAAAGTCCCTTTCCGATTCGAATGCTCATGTCCGAGCCCTGGCACTGAGAACAATG
TCGGGCATTCGCGTCCCCGTCATTAGCCAGATTGTTTCGCTGGCTGTGAAAAAGGGCGTGGCAGACATGAGCCCT
CTTGTGCGCAAGGCCGCCGCCCTGGCTATTCCAAAGTGCTATCGGCTTGATCCCACCCAGGCGCCGCAACTGCTC
GAGTATCTGGCCGCTCTGCTGGGCGATAGGCAGTATTACGTGGCTGGAGCTGCCGTGTGCGCCCATCTCGAGATT
TGCCCCAATGAAATCCATCTTATTCACCCGCACTACCGGTCTCTGGTTCGCAAGATTGTCGACATGGATGAGTGG
AGCCAGTTGGCTGCCCTTCGCCTCATGACAATTTATGCCCGCCGTTGCTTTCCTACAAGAACACACGAGCCAGCA
GAGCAGTCACATGGCAACGCGACAAGGCCAAGTAGAGGCTCTCAAGCCTCGTCGCCCAACCCAGACTTGCTGCTT
CTACTCAATTCCATCAGACCTCTGCTGCAGAGCCGCAACTCGGGCGTCGTAATTGCTGTAACGCGGTGCTATGTC
AATGTCGGCACAGATGACCATGTCGCGCTTGCTATTGGCCCTCTTGTGGCGCTGCTCCGAGGCGCCGACGACATT
CAACAAGTGGCCCTCTACAACATTGTCGCCGTTTGCCTGACACGGCCAGGTGACTTTGTAAAGTACGCCACGCAT
TTCCTCGTCCGGGCCACCGATTCGCCAGGCGTGTGGGAGCTGAAGCTGGAGCTCCTTACCATCATCTTTCCACAC
AGCCCTAGCCACGTCAAAAGCCTCATCCTCAAGGAGCTCCAGCACTTTTCTCGCGGCTCCAACAAGGCTCTGGTG
CGCGAAGCAGTCCGCGCCATTGGACGCTGTGCGCAGACAGACGCGGCCACGGCGCCTCGCTGCCTCAAGCTCCTC
CTCGGCCAAATCACCAGCCTCGACGGGACGCTGGCGGCCGAGTCGCTGACTGTCATTCGGCACCTCATTCAGCAG
GATGCACAGAATCACGTGGGCACCGTGGTGCGCTTGGCCAAGAACCTCGACTCTGCCACGGATCCGCAGGCCAGA
GCAACCATTATCTGGCTCGTAGGCGAATTTTCAGGCCTCAATAACGAGGACAATATTGCGCCCGACGTGTTGCGC
ATCCTCCTCAAGGACTTTGCCAGCGAGTCGGAAGCCGCCAAGCGCCAAATCTTGCTCCTGGCTGCAAAAGTTCAC
CTCCACCAGTTAAACCGCCAAGCCGAGGCGCTCAAGCAGGACGACGCAACCCCGGATACAGAAGCGCCGGATGCA
CACAGCCACCCCACAGCCCGCCTGTGGGAATATATTCTCCTCCTTGTACGCTACGACACGTCGTTTGATCTTCGC
GACCGCGCTCGCATGTACCGCGCGCTGCTGGGCGTGCCACAGCTGGCAACGCTCATGCTCCTCGCACCCAAGCCC
GCCCCGCAGACACCCAGTCCGTCCGAGGCGCGGCGCGGCTTCCTTCTCGGGTCGGCGACGCTGGTGCTCGCGGGC
GGGGGCGGCGTGCATGGCCTGAGCGGCTACGCGGCGCTGCCAGAGTGGGCGGCGCCGGGGATGGAGCCGGATCCG
AGACTAAGGGATGACCAGGATGGTGGGCGGACCAAGAGCGGTGACAGAGGCGTGGCGGTTGAGAGGCTCGAGGAA
GCAACAAGGCAGGTGGGAGGGATGAATGGCATGGGTACAAAGACGCTGGATGACTGGTTGGCTGAGGGGAGTGAC
AAGAGTCAAGAGGAAGCGCAAGAGACCGAGTCGGAAGAGGAGGATGAGGATGAAGAGGGGAGTGAGGAAGATGAA
GAAGAGAGCGAGGATGATGAGGACGAGGAAGAGGAAGAAAGTGAGGACGAGGATGAGGGCGAAGGAGACGGATTG
ATCAAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail