Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7246
Gene name
LocationContig_822:3906..4701
Strand+
Gene length (bp)795
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase 2.3E-27 129 257
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 8.5E-22 23 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XTI0|3HIDH_CAEEL Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0250.5 PE=3 SV=1 26 257 7.0E-56
sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=1 SV=1 23 262 2.0E-55
sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 23 261 3.0E-55
sp|Q54CX6|3HIDH_DICDI Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=hibA PE=3 SV=1 23 258 4.0E-54
sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 22 257 6.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XTI0|3HIDH_CAEEL Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0250.5 PE=3 SV=1 26 257 7.0E-56
sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=1 SV=1 23 262 2.0E-55
sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 23 261 3.0E-55
sp|Q54CX6|3HIDH_DICDI Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=hibA PE=3 SV=1 23 258 4.0E-54
sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 22 257 6.0E-53
sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2 23 261 1.0E-51
sp|Q2HJD7|3HIDH_BOVIN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=HIBADH PE=2 SV=1 23 261 2.0E-51
sp|Q5R5E7|3HIDH_PONAB 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Pongo abelii GN=HIBADH PE=2 SV=1 23 261 3.0E-51
sp|Q9SUC0|3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=At4g20930 PE=2 SV=3 23 261 4.0E-48
sp|P28811|MMSB_PSEAE 3-hydroxyisobutyrate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mmsB PE=2 SV=1 23 261 5.0E-46
sp|P9WNY5|MMSB_MYCTU Probable 3-hydroxyisobutyrate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmsB PE=1 SV=1 23 260 3.0E-39
sp|P9WNY4|MMSB_MYCTO Probable 3-hydroxyisobutyrate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmsB PE=3 SV=1 23 260 3.0E-39
sp|P63936|MMSB_MYCBO Probable 3-hydroxyisobutyrate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mmsB PE=3 SV=1 23 260 3.0E-39
sp|Q9I5I6|SERDH_PSEAE NAD-dependent L-serine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0743 PE=1 SV=1 23 263 6.0E-37
sp|Q0QLF5|HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri GN=Hgd PE=1 SV=1 23 255 5.0E-33
sp|P77161|GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=glxR PE=2 SV=1 23 220 1.0E-20
sp|P0ABQ2|GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=garR PE=1 SV=1 23 228 3.0E-18
sp|P0ABQ3|GARR_ECOL6 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=garR PE=3 SV=1 23 228 3.0E-18
sp|O34948|YKWC_BACSU Uncharacterized oxidoreductase YkwC OS=Bacillus subtilis (strain 168) GN=ykwC PE=3 SV=1 23 237 1.0E-17
sp|O33730|Y1503_SHEFN Uncharacterized oxidoreductase Sfri_1503 OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_1503 PE=3 SV=2 22 240 3.0E-13
sp|Q9SZE1|3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana GN=At4g29120 PE=1 SV=1 23 223 1.0E-12
sp|Q55702|Y229_SYNY3 Uncharacterized oxidoreductase slr0229 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0229 PE=3 SV=1 23 233 3.0E-12
sp|F4I907|GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana GN=GLYR2 PE=1 SV=1 55 264 3.0E-12
sp|Q9L7S0|SQUU_SALTY 3-sulfolactaldehyde reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yihU PE=3 SV=1 19 257 1.0E-11
sp|P0A9V9|SQUU_SHIFL 3-sulfolactaldehyde reductase OS=Shigella flexneri GN=yihU PE=3 SV=1 23 257 1.0E-10
sp|P0A9V8|SQUU_ECOLI 3-sulfolactaldehyde reductase OS=Escherichia coli (strain K12) GN=yihU PE=1 SV=1 23 257 1.0E-10
sp|Q9C991|3HID2_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial OS=Arabidopsis thaliana GN=At1g71170 PE=2 SV=1 18 213 6.0E-08
sp|Q562D5|GLYR1_XENTR Putative oxidoreductase GLYR1 OS=Xenopus tropicalis GN=glyr1 PE=2 SV=1 52 255 1.0E-07
sp|Q9LSV0|GLYR1_ARATH Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana GN=GLYR1 PE=1 SV=1 55 253 6.0E-07
sp|O34969|YFJR_BACSU Uncharacterized oxidoreductase YfjR OS=Bacillus subtilis (strain 168) GN=yfjR PE=3 SV=2 23 237 5.0E-06
sp|Q949M8|3HID3_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial OS=Arabidopsis thaliana GN=At1g71180 PE=2 SV=1 18 214 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0051287 NAD binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7246
MLPIPKSPPLLFLLTLVLTLLQDIAITVLPEPQHVRAVYQSITANPQPPAHRVLIDCSTIDPSTSRHVAKMMADA
GQGAFVDAPMSGGVVGATAATLTFMLGAPSALVPRVEPALLLMGRKVLHCGAQGAGLSAKLANNYLLALNNIATA
EAMNLGMRWGLDPATLAGVINVSTGRCWPSEVNNPVKGVVNTAAASRNYRGGFGISLMKKDLGLAMVAAKEAGAK
MALAETAFAVYDDAEKRPDCSGRDFSVVYRYLDGKEPQD*
Coding >OphauG2|7246
ATGCTCCCAATTCCAAAATCACCCCCCCTTCTTTTCTTGTTGACCTTGGTGCTGACCCTTCTTCAGGACATAGCC
ATTACCGTTCTGCCCGAACCACAGCACGTCCGCGCAGTCTACCAGTCCATCACCGCCAACCCTCAACCCCCCGCC
CACCGCGTCTTGATCGACTGCTCAACAATCGACCCCTCCACCTCGCGTCACGTGGCCAAGATGATGGCCGACGCA
GGCCAGGGCGCCTTTGTCGATGCCCCAATGTCTGGTGGTGTCGTCGGCGCCACCGCCGCTACCCTAACCTTTATG
CTCGGCGCCCCCTCAGCCCTGGTGCCCAGAGTCGAGCCGGCTCTCTTGCTCATGGGCCGCAAGGTGCTTCACTGC
GGCGCCCAAGGTGCCGGCCTCTCGGCAAAGCTCGCAAACAACTACCTCCTTGCCCTCAACAATATTGCCACGGCA
GAGGCCATGAACCTGGGCATGCGCTGGGGCCTCGACCCTGCCACTCTAGCTGGCGTTATCAACGTGAGCACCGGC
CGCTGCTGGCCCAGCGAGGTGAATAACCCCGTCAAGGGCGTCGTCAACACTGCTGCTGCCTCCAGAAACTACCGC
GGCGGCTTCGGCATCTCCCTCATGAAGAAGGACCTTGGCCTCGCAATGGTTGCTGCAAAGGAGGCTGGCGCTAAA
ATGGCACTCGCCGAAACCGCCTTTGCTGTCTACGACGATGCTGAGAAGCGTCCAGACTGCAGTGGCCGCGACTTC
TCAGTCGTCTACCGCTATCTCGACGGCAAGGAGCCTCAAGATTAG
Transcript >OphauG2|7246
ATGCTCCCAATTCCAAAATCACCCCCCCTTCTTTTCTTGTTGACCTTGGTGCTGACCCTTCTTCAGGACATAGCC
ATTACCGTTCTGCCCGAACCACAGCACGTCCGCGCAGTCTACCAGTCCATCACCGCCAACCCTCAACCCCCCGCC
CACCGCGTCTTGATCGACTGCTCAACAATCGACCCCTCCACCTCGCGTCACGTGGCCAAGATGATGGCCGACGCA
GGCCAGGGCGCCTTTGTCGATGCCCCAATGTCTGGTGGTGTCGTCGGCGCCACCGCCGCTACCCTAACCTTTATG
CTCGGCGCCCCCTCAGCCCTGGTGCCCAGAGTCGAGCCGGCTCTCTTGCTCATGGGCCGCAAGGTGCTTCACTGC
GGCGCCCAAGGTGCCGGCCTCTCGGCAAAGCTCGCAAACAACTACCTCCTTGCCCTCAACAATATTGCCACGGCA
GAGGCCATGAACCTGGGCATGCGCTGGGGCCTCGACCCTGCCACTCTAGCTGGCGTTATCAACGTGAGCACCGGC
CGCTGCTGGCCCAGCGAGGTGAATAACCCCGTCAAGGGCGTCGTCAACACTGCTGCTGCCTCCAGAAACTACCGC
GGCGGCTTCGGCATCTCCCTCATGAAGAAGGACCTTGGCCTCGCAATGGTTGCTGCAAAGGAGGCTGGCGCTAAA
ATGGCACTCGCCGAAACCGCCTTTGCTGTCTACGACGATGCTGAGAAGCGTCCAGACTGCAGTGGCCGCGACTTC
TCAGTCGTCTACCGCTATCTCGACGGCAAGGAGCCTCAAGATTAG
Gene >OphauG2|7246
ATGCTCCCAATTCCAAAATCACCCCCCCTTCTTTTCTTGTTGACCTTGGTGCTGACCCTTCTTCAGGACATAGCC
ATTACCGTTCTGCCCGAACCACAGCACGTCCGCGCAGTCTACCAGTCCATCACCGCCAACCCTCAACCCCCCGCC
CACCGCGTCTTGATCGACTGCTCAACAATCGACCCCTCCACCTCGCGTCACGTGGCCAAGATGATGGCCGACGCA
GGCCAGGGCGCCTTTGTCGATGCCCCAATGTCTGGTGGTGTCGTCGGCGCCACCGCCGCTACCCTAACCTTTATG
CTCGGCGCCCCCTCAGCCCTGGTGCCCAGAGTCGAGCCGGCTCTCTTGCTCATGGGCCGCAAGGTGCTTCACTGC
GGCGCCCAAGGTGCCGGCCTCTCGGCAAAGCTCGCAAACAACTACCTCCTTGCCCTCAACAATATTGCCACGGCA
GAGGCCATGAACCTGGGCATGCGCTGGGGCCTCGACCCTGCCACTCTAGCTGGCGTTATCAACGTGAGCACCGGC
CGCTGCTGGCCCAGCGAGGTGAATAACCCCGTCAAGGGCGTCGTCAACACTGCTGCTGCCTCCAGAAACTACCGC
GGCGGCTTCGGCATCTCCCTCATGAAGAAGGACCTTGGCCTCGCAATGGTTGCTGCAAAGGAGGCTGGCGCTAAA
ATGGCACTCGCCGAAACCGCCTTTGCTGTCTACGACGATGCTGAGAAGCGTCCAGACTGCAGTGGCCGCGACTTC
TCAGTCGTCTACCGCTATCTCGACGGCAAGGAGCCTCAAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail