Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|724
Gene name
LocationContig_1187:3845..5216
Strand-
Gene length (bp)1371
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2728
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1528
Ophiocordyceps australis 1348a (Ghana) OphauG2|724 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7108
Ophiocordyceps australis map64 (Brazil) OphauB2|8109
Ophiocordyceps kimflemingae Ophio5|6056
Ophiocordyceps subramaniannii Hirsu2|4294

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|724
MDDSAKTSKTRAETALVTERPSSDGGMATLEYNSVILTEYACPSTAKCPSKSIAVTKIVPSYTVICPASLVTALA
QPEALPNSAKKVTITATVTVIRTISKCAVEATKCRAGAVATNYSTVTYCPAKQTEVALGVDGGEYVKLDAQVTKV
AQPVREAQGSPSHRQDSLAMGGTAASLGDSSGAEQDSRANKDAVPGRVVNITYRLKKKPKAPEQSPSSSSPLSPP
DPGEPSDNHHLFSSDQLSAPRPKHKGQVETPDTHGPGEYPAARKGRLGPGYAGDGPRFEAKTPSGHGGHVVTDED
VCQGDGPCGEAWSDEHGAAAGPDPGPVLDPDSGPDSGPDPGPGPHHAPPHAPPHAPPHDPLLHTDPSSGVAPAGS
SRIASSGPSRIASPGPSRIASPGPSRKSPSPHGSGPGAKANPCVGAECDGLLTSASCRVGASAMAIVVAVVVALW
ERRLLG*
Coding >OphauG2|724
ATGGATGACTCGGCCAAGACATCCAAGACGCGTGCCGAGACAGCCTTGGTGACGGAGCGGCCAAGCAGCGACGGC
GGCATGGCCACGCTCGAGTACAACAGCGTCATCTTGACCGAGTACGCTTGCCCTAGCACGGCCAAATGTCCCAGC
AAGAGCATCGCCGTGACCAAGATTGTGCCGTCCTATACCGTCATCTGTCCGGCCAGCCTGGTTACGGCTTTGGCC
CAGCCCGAGGCTCTGCCCAACTCGGCCAAAAAGGTGACCATTACGGCCACCGTGACGGTGATTCGCACCATCAGC
AAGTGCGCGGTCGAGGCTACAAAGTGCCGTGCCGGGGCCGTTGCCACAAACTACTCGACTGTCACCTATTGTCCA
GCCAAGCAGACCGAGGTTGCCCTGGGTGTTGATGGCGGCGAGTACGTCAAGCTGGATGCCCAAGTCACCAAGGTT
GCCCAGCCAGTCCGCGAAGCACAAGGCTCGCCAAGCCACAGGCAAGACAGCCTGGCCATGGGCGGGACTGCGGCG
TCACTTGGCGACTCTTCTGGTGCCGAGCAGGACAGTCGGGCCAACAAGGATGCTGTGCCTGGGCGCGTAGTCAAC
ATTACATACCGTCTCAAGAAGAAGCCCAAGGCCCCCGAGCAAAGTCCCAGCAGCAGCAGCCCGCTAAGCCCCCCC
GACCCTGGCGAGCCGTCCGACAATCACCACCTCTTTTCCAGCGACCAGCTATCGGCGCCTCGGCCCAAGCACAAG
GGCCAAGTTGAGACGCCAGACACCCACGGCCCTGGAGAATATCCTGCTGCACGCAAGGGTCGGCTCGGCCCCGGA
TATGCAGGAGACGGGCCTCGTTTCGAGGCAAAGACTCCTTCTGGGCATGGTGGCCATGTCGTCACTGACGAGGAC
GTTTGTCAAGGAGACGGCCCCTGTGGCGAGGCTTGGTCAGATGAGCATGGCGCAGCCGCAGGTCCTGATCCTGGT
CCTGTTCTTGATCCTGATTCTGGTCCTGATTCTGGTCCTGATCCTGGTCCTGGTCCCCATCATGCTCCTCCTCAT
GCTCCTCCTCATGCTCCTCCTCATGATCCTCTTTTGCACACAGATCCGTCGTCGGGTGTTGCTCCTGCAGGCTCA
AGTCGCATTGCGTCTTCCGGCCCAAGTCGCATTGCGTCTCCCGGCCCAAGTCGCATTGCGTCTCCCGGCCCAAGC
CGCAAGTCGCCTTCCCCTCATGGTTCAGGTCCGGGTGCCAAGGCAAATCCTTGCGTCGGTGCCGAGTGTGATGGA
TTGCTAACGTCAGCCTCGTGTCGGGTGGGGGCGAGTGCCATGGCTATTGTTGTTGCTGTGGTGGTGGCTTTGTGG
GAGAGGAGGCTTTTGGGTTGA
Transcript >OphauG2|724
ATGGATGACTCGGCCAAGACATCCAAGACGCGTGCCGAGACAGCCTTGGTGACGGAGCGGCCAAGCAGCGACGGC
GGCATGGCCACGCTCGAGTACAACAGCGTCATCTTGACCGAGTACGCTTGCCCTAGCACGGCCAAATGTCCCAGC
AAGAGCATCGCCGTGACCAAGATTGTGCCGTCCTATACCGTCATCTGTCCGGCCAGCCTGGTTACGGCTTTGGCC
CAGCCCGAGGCTCTGCCCAACTCGGCCAAAAAGGTGACCATTACGGCCACCGTGACGGTGATTCGCACCATCAGC
AAGTGCGCGGTCGAGGCTACAAAGTGCCGTGCCGGGGCCGTTGCCACAAACTACTCGACTGTCACCTATTGTCCA
GCCAAGCAGACCGAGGTTGCCCTGGGTGTTGATGGCGGCGAGTACGTCAAGCTGGATGCCCAAGTCACCAAGGTT
GCCCAGCCAGTCCGCGAAGCACAAGGCTCGCCAAGCCACAGGCAAGACAGCCTGGCCATGGGCGGGACTGCGGCG
TCACTTGGCGACTCTTCTGGTGCCGAGCAGGACAGTCGGGCCAACAAGGATGCTGTGCCTGGGCGCGTAGTCAAC
ATTACATACCGTCTCAAGAAGAAGCCCAAGGCCCCCGAGCAAAGTCCCAGCAGCAGCAGCCCGCTAAGCCCCCCC
GACCCTGGCGAGCCGTCCGACAATCACCACCTCTTTTCCAGCGACCAGCTATCGGCGCCTCGGCCCAAGCACAAG
GGCCAAGTTGAGACGCCAGACACCCACGGCCCTGGAGAATATCCTGCTGCACGCAAGGGTCGGCTCGGCCCCGGA
TATGCAGGAGACGGGCCTCGTTTCGAGGCAAAGACTCCTTCTGGGCATGGTGGCCATGTCGTCACTGACGAGGAC
GTTTGTCAAGGAGACGGCCCCTGTGGCGAGGCTTGGTCAGATGAGCATGGCGCAGCCGCAGGTCCTGATCCTGGT
CCTGTTCTTGATCCTGATTCTGGTCCTGATTCTGGTCCTGATCCTGGTCCTGGTCCCCATCATGCTCCTCCTCAT
GCTCCTCCTCATGCTCCTCCTCATGATCCTCTTTTGCACACAGATCCGTCGTCGGGTGTTGCTCCTGCAGGCTCA
AGTCGCATTGCGTCTTCCGGCCCAAGTCGCATTGCGTCTCCCGGCCCAAGTCGCATTGCGTCTCCCGGCCCAAGC
CGCAAGTCGCCTTCCCCTCATGGTTCAGGTCCGGGTGCCAAGGCAAATCCTTGCGTCGGTGCCGAGTGTGATGGA
TTGCTAACGTCAGCCTCGTGTCGGGTGGGGGCGAGTGCCATGGCTATTGTTGTTGCTGTGGTGGTGGCTTTGTGG
GAGAGGAGGCTTTTGGGTTGA
Gene >OphauG2|724
ATGGATGACTCGGCCAAGACATCCAAGACGCGTGCCGAGACAGCCTTGGTGACGGAGCGGCCAAGCAGCGACGGC
GGCATGGCCACGCTCGAGTACAACAGCGTCATCTTGACCGAGTACGCTTGCCCTAGCACGGCCAAATGTCCCAGC
AAGAGCATCGCCGTGACCAAGATTGTGCCGTCCTATACCGTCATCTGTCCGGCCAGCCTGGTTACGGCTTTGGCC
CAGCCCGAGGCTCTGCCCAACTCGGCCAAAAAGGTGACCATTACGGCCACCGTGACGGTGATTCGCACCATCAGC
AAGTGCGCGGTCGAGGCTACAAAGTGCCGTGCCGGGGCCGTTGCCACAAACTACTCGACTGTCACCTATTGTCCA
GCCAAGCAGACCGAGGTTGCCCTGGGTGTTGATGGCGGCGAGTACGTCAAGCTGGATGCCCAAGTCACCAAGGTT
GCCCAGCCAGTCCGCGAAGCACAAGGCTCGCCAAGCCACAGGCAAGACAGCCTGGCCATGGGCGGGACTGCGGCG
TCACTTGGCGACTCTTCTGGTGCCGAGCAGGACAGTCGGGCCAACAAGGATGCTGTGCCTGGGCGCGTAGTCAAC
ATTACATACCGTCTCAAGAAGAAGCCCAAGGCCCCCGAGCAAAGTCCCAGCAGCAGCAGCCCGCTAAGCCCCCCC
GACCCTGGCGAGCCGTCCGACAATCACCACCTCTTTTCCAGCGACCAGCTATCGGCGCCTCGGCCCAAGCACAAG
GGCCAAGTTGAGACGCCAGACACCCACGGCCCTGGAGAATATCCTGCTGCACGCAAGGGTCGGCTCGGCCCCGGA
TATGCAGGAGACGGGCCTCGTTTCGAGGCAAAGACTCCTTCTGGGCATGGTGGCCATGTCGTCACTGACGAGGAC
GTTTGTCAAGGAGACGGCCCCTGTGGCGAGGCTTGGTCAGATGAGCATGGCGCAGCCGCAGGTCCTGATCCTGGT
CCTGTTCTTGATCCTGATTCTGGTCCTGATTCTGGTCCTGATCCTGGTCCTGGTCCCCATCATGCTCCTCCTCAT
GCTCCTCCTCATGCTCCTCCTCATGATCCTCTTTTGCACACAGATCCGTCGTCGGGTGTTGCTCCTGCAGGCTCA
AGTCGCATTGCGTCTTCCGGCCCAAGTCGCATTGCGTCTCCCGGCCCAAGTCGCATTGCGTCTCCCGGCCCAAGC
CGCAAGTCGCCTTCCCCTCATGGTTCAGGTCCGGGTGCCAAGGCAAATCCTTGCGTCGGTGCCGAGTGTGATGGA
TTGCTAACGTCAGCCTCGTGTCGGGTGGGGGCGAGTGCCATGGCTATTGTTGTTGCTGTGGTGGTGGCTTTGTGG
GAGAGGAGGCTTTTGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail