Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7239
Gene name
LocationContig_820:7474..7982
Strand-
Gene length (bp)508
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.9E-14 7 67

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59670|SF3B6_SCHPO Splicing factor 3B subunit 6-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.07c PE=3 SV=2 7 100 6.0E-33
sp|Q9VRV7|SF3B6_DROME Splicing factor 3B subunit 6-like protein OS=Drosophila melanogaster GN=CG13298 PE=1 SV=1 8 100 3.0E-30
sp|Q8ITY4|SF3B6_CAEEL Splicing factor 3B subunit 6-like protein OS=Caenorhabditis elegans GN=C50D2.5 PE=3 SV=2 8 100 5.0E-30
sp|P59708|SF3B6_MOUSE Splicing factor 3B subunit 6 OS=Mus musculus GN=Sf3b6 PE=1 SV=1 7 101 5.0E-30
sp|Q9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 OS=Homo sapiens GN=SF3B6 PE=1 SV=1 7 101 5.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59670|SF3B6_SCHPO Splicing factor 3B subunit 6-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.07c PE=3 SV=2 7 100 6.0E-33
sp|Q9VRV7|SF3B6_DROME Splicing factor 3B subunit 6-like protein OS=Drosophila melanogaster GN=CG13298 PE=1 SV=1 8 100 3.0E-30
sp|Q8ITY4|SF3B6_CAEEL Splicing factor 3B subunit 6-like protein OS=Caenorhabditis elegans GN=C50D2.5 PE=3 SV=2 8 100 5.0E-30
sp|P59708|SF3B6_MOUSE Splicing factor 3B subunit 6 OS=Mus musculus GN=Sf3b6 PE=1 SV=1 7 101 5.0E-30
sp|Q9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 OS=Homo sapiens GN=SF3B6 PE=1 SV=1 7 101 5.0E-30
sp|Q9FMP4|SF3B6_ARATH Splicing factor 3B subunit 6-like protein OS=Arabidopsis thaliana GN=At5g12190 PE=2 SV=1 8 100 3.0E-28
sp|Q54J05|RU2B_DICDI U2 small nuclear ribonucleoprotein B'' OS=Dictyostelium discoideum GN=snrpb2 PE=3 SV=1 13 89 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7239
MLTELCSYHVTPEELFDLFGKFGPIRQVRQGISSTTKGTAFVVYEDVMDAKQACDKLNGFNFQNRYLVVLYHQPE
KMIKSREDLEARRESLAQLKKQHGID*
Coding >OphauG2|7239
ATGTTGACAGAGCTCTGTTCCTACCACGTCACACCCGAAGAGCTCTTTGATCTCTTTGGCAAGTTTGGCCCAATC
CGTCAAGTGCGCCAGGGCATCTCGAGCACCACCAAGGGAACAGCGTTTGTTGTCTACGAGGATGTCATGGATGCC
AAGCAAGCTTGCGACAAGCTGAATGGTTTCAACTTTCAGAATCGCTACCTAGTTGTTCTATATCACCAGCCCGAG
AAGATGATCAAGTCGAGAGAAGATCTCGAGGCCCGCCGAGAATCTTTAGCCCAACTCAAGAAGCAGCACGGTATT
GATTGA
Transcript >OphauG2|7239
ATGTTGACAGAGCTCTGTTCCTACCACGTCACACCCGAAGAGCTCTTTGATCTCTTTGGCAAGTTTGGCCCAATC
CGTCAAGTGCGCCAGGGCATCTCGAGCACCACCAAGGGAACAGCGTTTGTTGTCTACGAGGATGTCATGGATGCC
AAGCAAGCTTGCGACAAGCTGAATGGTTTCAACTTTCAGAATCGCTACCTAGTTGTTCTATATCACCAGCCCGAG
AAGATGATCAAGTCGAGAGAAGATCTCGAGGCCCGCCGAGAATCTTTAGCCCAACTCAAGAAGCAGCACGGTATT
GATTGA
Gene >OphauG2|7239
ATGTTGACAGAGCTCTGTTCGTCAAGAATTTGAGGTGTGCCTCTGCGGACTTGGATTCGATTGGCTCCAAACTGA
CTGTTTCCCCTCCATTCCAGCTACCACGTCACACCCGAAGAGCTCTTTGATCTCTTTGGCAAGTTTGGCCCAATC
CGGTAAATTTCTCCATCAACTCATCGTTACCTTGACAACATGCTGACGGTCCCTTGTAGTCAAGTGCGCCAGGGC
ATCTCGAGCACCACCAAGGGAACAGCGTTTGTTGTCTACGAGGATGTCATGGATGCCAAGCAAGCTTGCGACAAG
CTGAATGGTTTCAACTTTCAGAATCGCTACCTAGTTGGTACGTCCCCCTAGTCGTCTCCTCTGTTGCATGCTGTG
CCGCCCACGACAATTCTAACGTGTCCCGATAGTTCTATATCACCAGCCCGAGAAGATGATCAAGTCGAGAGAAGA
TCTCGAGGCCCGCCGAGAATCTTTAGCCCAACTCAAGAAGCAGCACGGTATTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail