Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|723
Gene name
LocationContig_1186:3878..4749
Strand-
Gene length (bp)871
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13869 NUDIX_2 Nucleotide hydrolase 9.6E-81 28 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GXS3|CFIS2_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 2 OS=Arabidopsis thaliana GN=CFIS2 PE=1 SV=1 29 226 1.0E-77
sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity factor subunit 5 OS=Danio rerio GN=cpsf5 PE=2 SV=1 29 221 7.0E-69
sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity factor subunit 5 OS=Xenopus laevis GN=cpsf5 PE=2 SV=1 29 221 1.0E-68
sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity factor subunit 5 OS=Pongo abelii GN=NUDT21 PE=2 SV=1 29 221 1.0E-68
sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1 29 221 1.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GXS3|CFIS2_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 2 OS=Arabidopsis thaliana GN=CFIS2 PE=1 SV=1 29 226 1.0E-77
sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity factor subunit 5 OS=Danio rerio GN=cpsf5 PE=2 SV=1 29 221 7.0E-69
sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity factor subunit 5 OS=Xenopus laevis GN=cpsf5 PE=2 SV=1 29 221 1.0E-68
sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity factor subunit 5 OS=Pongo abelii GN=NUDT21 PE=2 SV=1 29 221 1.0E-68
sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1 29 221 1.0E-68
sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity factor subunit 5 OS=Bos taurus GN=NUDT21 PE=2 SV=1 29 221 1.0E-68
sp|Q4KM65|CPSF5_RAT Cleavage and polyadenylation specificity factor subunit 5 OS=Rattus norvegicus GN=Nudt21 PE=2 SV=1 29 221 1.0E-68
sp|Q9CQF3|CPSF5_MOUSE Cleavage and polyadenylation specificity factor subunit 5 OS=Mus musculus GN=Nudt21 PE=1 SV=1 29 221 1.0E-68
sp|Q94AF0|CFIS1_ARATH Pre-mRNA cleavage factor Im 25 kDa subunit 1 OS=Arabidopsis thaliana GN=CFIS1 PE=1 SV=1 29 225 2.0E-60
sp|Q55E68|CPSF5_DICDI Cleavage and polyadenylation specificity factor subunit 5 OS=Dictyostelium discoideum GN=cpsf5 PE=3 SV=1 27 225 1.0E-55
[Show less]

GO

GO Term Description Terminal node
GO:0005849 mRNA cleavage factor complex Yes
GO:0003729 mRNA binding Yes
GO:0006378 mRNA polyadenylation Yes
GO:0006397 mRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No
GO:0031123 RNA 3'-end processing No
GO:0006396 RNA processing No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043631 RNA polyadenylation No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0016071 mRNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0003676 nucleic acid binding No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0031124 mRNA 3'-end processing No
GO:0003674 molecular_function No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003723 RNA binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1097
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|723 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5667
Ophiocordyceps camponoti-floridani Ophcf2|05030
Ophiocordyceps camponoti-rufipedis Ophun1|4604
Ophiocordyceps kimflemingae Ophio5|2099
Ophiocordyceps subramaniannii Hirsu2|1011

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|723
MSTIPEPMLQSGNPPIIPLSFNSRQPEKVTLYPLSNYTFGVKETQPEEDPSVIARLKRLEEHYAEHGMRRTCEGI
LVCHEHNHPHILMLQIANAFFKLPGDYLRPNDDEVEGFKMRLDERLAPVGRIGEGAEAGDWQVGECLAQWWRPNF
ETFMYPFVPAHVTRPKECKKLYFIHLPKAKVLSVPKNMKLLAVPLFELYDNTARYGPQLSAIPHILSRYNFEFID
ENGNVAAVTPGSGAPEGYTPKVKVLAQGDTEMNGTDEKGVQ*
Coding >OphauG2|723
ATGTCCACCATCCCCGAGCCAATGCTGCAGTCGGGAAATCCCCCCATTATTCCTCTCTCCTTCAACTCGAGACAA
CCGGAAAAGGTGACCTTGTATCCTCTGTCGAATTACACCTTTGGGGTCAAGGAAACCCAGCCGGAAGAGGACCCA
TCTGTCATCGCGCGCCTCAAGCGCCTCGAAGAACATTACGCCGAACACGGCATGCGCCGCACCTGCGAGGGCATT
CTCGTCTGCCATGAGCACAACCACCCCCACATACTCATGCTTCAGATCGCCAATGCATTCTTCAAGCTTCCCGGA
GATTACCTGCGTCCTAATGACGACGAGGTGGAAGGATTCAAAATGCGCCTTGACGAACGCCTCGCCCCAGTCGGC
CGCATTGGCGAGGGTGCAGAGGCTGGCGACTGGCAGGTTGGCGAGTGCCTGGCTCAGTGGTGGCGGCCTAATTTC
GAAACATTCATGTACCCCTTTGTCCCTGCCCACGTCACGCGGCCCAAGGAGTGTAAAAAGCTGTACTTCATCCAT
TTACCAAAAGCCAAGGTCTTGAGCGTCCCCAAAAACATGAAGCTCCTGGCAGTCCCTCTCTTTGAGCTCTACGAT
AACACGGCTCGCTACGGCCCACAGCTCTCGGCCATTCCACACATCTTGAGCCGGTACAACTTTGAATTCATCGAC
GAGAACGGGAACGTCGCTGCTGTAACTCCAGGCTCGGGGGCACCTGAAGGATACACGCCAAAAGTAAAAGTCTTG
GCCCAAGGCGACACGGAGATGAACGGCACAGATGAGAAAGGAGTACAGTGA
Transcript >OphauG2|723
ATGTCCACCATCCCCGAGCCAATGCTGCAGTCGGGAAATCCCCCCATTATTCCTCTCTCCTTCAACTCGAGACAA
CCGGAAAAGGTGACCTTGTATCCTCTGTCGAATTACACCTTTGGGGTCAAGGAAACCCAGCCGGAAGAGGACCCA
TCTGTCATCGCGCGCCTCAAGCGCCTCGAAGAACATTACGCCGAACACGGCATGCGCCGCACCTGCGAGGGCATT
CTCGTCTGCCATGAGCACAACCACCCCCACATACTCATGCTTCAGATCGCCAATGCATTCTTCAAGCTTCCCGGA
GATTACCTGCGTCCTAATGACGACGAGGTGGAAGGATTCAAAATGCGCCTTGACGAACGCCTCGCCCCAGTCGGC
CGCATTGGCGAGGGTGCAGAGGCTGGCGACTGGCAGGTTGGCGAGTGCCTGGCTCAGTGGTGGCGGCCTAATTTC
GAAACATTCATGTACCCCTTTGTCCCTGCCCACGTCACGCGGCCCAAGGAGTGTAAAAAGCTGTACTTCATCCAT
TTACCAAAAGCCAAGGTCTTGAGCGTCCCCAAAAACATGAAGCTCCTGGCAGTCCCTCTCTTTGAGCTCTACGAT
AACACGGCTCGCTACGGCCCACAGCTCTCGGCCATTCCACACATCTTGAGCCGGTACAACTTTGAATTCATCGAC
GAGAACGGGAACGTCGCTGCTGTAACTCCAGGCTCGGGGGCACCTGAAGGATACACGCCAAAAGTAAAAGTCTTG
GCCCAAGGCGACACGGAGATGAACGGCACAGATGAGAAAGGAGTACAGTGA
Gene >OphauG2|723
ATGTCCACCATCCCCGAGCCAATGCTGCAGTCGGGAAATCCCCCCATTATTCCTCTCTCCTTCAACTCGAGACAA
CCGGAAAAGGTGACCTTGTATCCTCTGTCGAATTACACCTTTGGGGTCAAGGAAACCCAGCCGGAAGAGGACCCA
TCTGTCATCGCGCGCCTCAAGCGCCTCGAAGAACATTACGCCGAACACGGCATGCGCCGCACCTGCGAGGGCATT
CTCGTCTGCCATGAGCACAACCACCCCCACATACTCATGCTTCAGATCGCCAATGCATTCTTCAAGCTTCCCGGA
GATTACCTGCGTCCTAATGACGACGAGGTGGAAGGATTCAAAATGCGCCTTGACGAACGCCTCGCCCCAGTCGGC
CGCATTGGCGAGGGTGCAGAGGCTGGCGACTGGCAGGTTGGCGAGTGCCTGGCTCAGTGGTGGCGGCCTAATTTC
GAAACATTCATGTACCCCTTTGTCCCTGCCCACGTCACGCGGCCCAAGGAGTGTAAAAAGCTGTACTTCATCCAT
TTACCAAAAGCCAGTACGTCAACCCTCCCTTCACCGTGCTTAATGGCATGCTAATTTAATTCCGCGCCGTCGCAA
TAATATAGAGGTCTTGAGCGTCCCCAAAAACATGAAGCTCCTGGCAGTCCCTCTCTTTGAGCTCTACGATAACAC
GGCTCGCTACGGCCCACAGCTCTCGGCCATTCCACACATCTTGAGCCGGTACAACTTTGAATTCATCGACGAGAA
CGGGAACGTCGCTGCTGTAACTCCAGGCTCGGGGGCACCTGAAGGATACACGCCAAAAGTAAAAGTCTTGGCCCA
AGGCGACACGGAGATGAACGGCACAGATGAGAAAGGAGTACAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail