Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7224
Gene name
LocationContig_817:7093..7802
Strand+
Gene length (bp)709
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01302 CAP_GLY CAP-Gly domain 1.7E-24 114 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10235|ALP11_SCHPO Cell polarity protein alp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp11 PE=1 SV=1 40 198 3.0E-46
sp|Q5E951|TBCB_BOVIN Tubulin-folding cofactor B OS=Bos taurus GN=TBCB PE=2 SV=1 47 193 4.0E-23
sp|Q99426|TBCB_HUMAN Tubulin-folding cofactor B OS=Homo sapiens GN=TBCB PE=1 SV=2 46 193 1.0E-22
sp|Q20728|TBCB_CAEEL Tubulin-specific chaperone B OS=Caenorhabditis elegans GN=tbcb-1 PE=1 SV=1 46 192 1.0E-22
sp|Q9D1E6|TBCB_MOUSE Tubulin-folding cofactor B OS=Mus musculus GN=Tbcb PE=1 SV=2 46 193 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10235|ALP11_SCHPO Cell polarity protein alp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp11 PE=1 SV=1 40 198 3.0E-46
sp|Q5E951|TBCB_BOVIN Tubulin-folding cofactor B OS=Bos taurus GN=TBCB PE=2 SV=1 47 193 4.0E-23
sp|Q99426|TBCB_HUMAN Tubulin-folding cofactor B OS=Homo sapiens GN=TBCB PE=1 SV=2 46 193 1.0E-22
sp|Q20728|TBCB_CAEEL Tubulin-specific chaperone B OS=Caenorhabditis elegans GN=tbcb-1 PE=1 SV=1 46 192 1.0E-22
sp|Q9D1E6|TBCB_MOUSE Tubulin-folding cofactor B OS=Mus musculus GN=Tbcb PE=1 SV=2 46 193 1.0E-22
sp|Q67Z52|TBCB_ARATH Tubulin-folding cofactor B OS=Arabidopsis thaliana GN=TFCB PE=1 SV=1 52 199 4.0E-18
sp|Q54Z01|TBCB_DICDI Tubulin-specific chaperone B OS=Dictyostelium discoideum GN=tbcb PE=3 SV=1 39 190 5.0E-16
sp|P53904|TBCB_YEAST Tubulin-specific chaperone B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALF1 PE=1 SV=1 62 186 8.0E-16
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 108 190 7.0E-12
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 108 190 1.0E-11
sp|Q01397|DYNA_NEUCR Dynactin, 150 kDa isoform OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-3 PE=3 SV=3 110 186 1.0E-11
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 108 190 2.0E-11
sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 108 190 6.0E-11
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 116 190 1.0E-10
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 116 190 1.0E-10
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 118 184 1.0E-08
sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 118 184 1.0E-08
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 118 184 2.0E-08
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 118 184 2.0E-08
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 118 184 2.0E-08
sp|Q5U243|CLIP3_XENLA CAP-Gly domain-containing linker protein 3 OS=Xenopus laevis GN=clip3 PE=2 SV=1 125 201 2.0E-08
sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 125 184 3.0E-08
sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 125 184 3.0E-08
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 108 179 3.0E-08
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 118 184 4.0E-08
sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 118 191 6.0E-08
sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 118 191 7.0E-08
sp|B9EHT4|CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus GN=Clip3 PE=1 SV=1 118 191 1.0E-07
sp|Q5U243|CLIP3_XENLA CAP-Gly domain-containing linker protein 3 OS=Xenopus laevis GN=clip3 PE=2 SV=1 118 191 2.0E-07
sp|B9EHT4|CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus GN=Clip3 PE=1 SV=1 125 195 2.0E-07
sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=2 119 184 2.0E-07
sp|Q5U378|TBCE_DANRE Tubulin-specific chaperone E OS=Danio rerio GN=tbce PE=2 SV=2 123 187 9.0E-07
sp|P33420|NIP80_YEAST Protein NIP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIP100 PE=1 SV=2 106 167 1.0E-06
sp|Q8CIV8|TBCE_MOUSE Tubulin-specific chaperone E OS=Mus musculus GN=Tbce PE=1 SV=1 112 188 3.0E-06
sp|Q66HD5|CLIP4_RAT CAP-Gly domain-containing linker protein 4 OS=Rattus norvegicus GN=Clip4 PE=1 SV=1 107 201 5.0E-06
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus GN=DCTN1 PE=1 SV=2 93 186 5.0E-06
sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 125 201 6.0E-06
sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 127 184 6.0E-06
sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus GN=Dctn1 PE=1 SV=3 93 186 1.0E-05
sp|Q6PCJ1|DCTN1_XENLA Dynactin subunit 1 OS=Xenopus laevis GN=dctn1 PE=2 SV=1 126 186 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7224
MNSPPPWPKLGGCCRFPVRVWAPFSNGPTKTDLVLVVRQVQDRRPPGARLNLNDASGVDKYVMPEEEYEKKSDSV
LAWKKAQKLGRFDPDAPRHEQARLEALECDVRQRGIAVDKRCRVGGDDTRRGIVRYVGQVPEIPSGKGVWVGVEL
DEPVGKNDGSIAGTRYWGQPAHLKHGVFVRPERIDVGDFPPMDDLEDMEEI*
Coding >OphauG2|7224
ATGAACTCGCCTCCGCCTTGGCCAAAGCTTGGCGGATGCTGCCGGTTTCCGGTTCGCGTCTGGGCCCCTTTTAGC
AATGGCCCAACAAAGACTGACCTGGTCCTGGTTGTGCGGCAGGTGCAGGACAGGCGCCCACCAGGGGCTCGCCTC
AATTTGAATGATGCATCGGGCGTCGACAAGTATGTGATGCCTGAAGAAGAATACGAAAAAAAATCAGACTCGGTG
CTTGCATGGAAGAAGGCGCAGAAACTCGGCCGCTTCGACCCCGACGCTCCCCGCCACGAACAGGCCAGGCTGGAG
GCTCTCGAATGCGACGTGCGCCAGCGGGGCATAGCGGTGGATAAGCGGTGTCGCGTTGGCGGTGACGACACGCGC
CGGGGGATCGTCAGATATGTGGGCCAAGTCCCTGAGATTCCCAGCGGCAAGGGTGTCTGGGTCGGCGTCGAGCTG
GACGAGCCGGTCGGCAAAAATGACGGTAGCATCGCTGGTACGCGCTACTGGGGACAGCCTGCCCATCTAAAGCAC
GGCGTCTTTGTGCGGCCAGAGCGCATCGATGTTGGCGACTTTCCTCCCATGGACGACTTGGAAGACATGGAGGAA
ATCTGA
Transcript >OphauG2|7224
ATGAACTCGCCTCCGCCTTGGCCAAAGCTTGGCGGATGCTGCCGGTTTCCGGTTCGCGTCTGGGCCCCTTTTAGC
AATGGCCCAACAAAGACTGACCTGGTCCTGGTTGTGCGGCAGGTGCAGGACAGGCGCCCACCAGGGGCTCGCCTC
AATTTGAATGATGCATCGGGCGTCGACAAGTATGTGATGCCTGAAGAAGAATACGAAAAAAAATCAGACTCGGTG
CTTGCATGGAAGAAGGCGCAGAAACTCGGCCGCTTCGACCCCGACGCTCCCCGCCACGAACAGGCCAGGCTGGAG
GCTCTCGAATGCGACGTGCGCCAGCGGGGCATAGCGGTGGATAAGCGGTGTCGCGTTGGCGGTGACGACACGCGC
CGGGGGATCGTCAGATATGTGGGCCAAGTCCCTGAGATTCCCAGCGGCAAGGGTGTCTGGGTCGGCGTCGAGCTG
GACGAGCCGGTCGGCAAAAATGACGGTAGCATCGCTGGTACGCGCTACTGGGGACAGCCTGCCCATCTAAAGCAC
GGCGTCTTTGTGCGGCCAGAGCGCATCGATGTTGGCGACTTTCCTCCCATGGACGACTTGGAAGACATGGAGGAA
ATCTGA
Gene >OphauG2|7224
ATGAACTCGCCTCCGCCTTGGCCAAAGCTTGGCGGATGCTGCCGGTTTCCGGTTCGCGTCTGGGCCCCGTTGCCC
TTTTTTTTCTTTTTTCTTTTCCCCCACCTGACCGTGGTTTGCGTCGTTGCTCCTACTCCCTGTCTGTAATTGCTG
CGTGTTTTGCCATGGTTCTAGTTTTAGCAATGGCCCAACAAAGACTGACCTGGTCCTGGTTGTGCGGCAGGTGCA
GGACAGGCGCCCACCAGGGGCTCGCCTCAATTTGAATGATGCATCGGGCGTCGACAAGTATGTGATGCCTGAAGA
AGAATACGAAAAAAAATCAGACTCGGTGCTTGCATGGAAGAAGGCGCAGAAACTCGGCCGCTTCGACCCCGACGC
TCCCCGCCACGAACAGGCCAGGCTGGAGGCTCTCGAATGCGACGTGCGCCAGCGGGGCATAGCGGTGGATAAGCG
GTGTCGCGTTGGCGGTGACGACACGCGCCGGGGGATCGTCAGATATGTGGGCCAAGTCCCTGAGATTCCCAGCGG
CAAGGGTGTCTGGGTCGGCGTCGAGCTGGACGAGCCGGTCGGCAAAAATGACGGTAGCATCGCTGGTACGCGCTA
CTGGGGACAGCCTGCCCATCTAAAGCACGGCGTCTTTGTGCGGCCAGAGCGCATCGATGTTGGCGACTTTCCTCC
CATGGACGACTTGGAAGACATGGAGGAAATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail