Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7216
Gene name
LocationContig_815:6605..8483
Strand+
Gene length (bp)1878
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08375 Rpn3_C Proteasome regulatory subunit C-terminal 5.7E-26 511 574
PF01399 PCI PCI domain 1.1E-20 406 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42897|RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn3 PE=3 SV=2 68 582 2.0E-142
sp|P14685|PSMD3_MOUSE 26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=1 SV=3 72 574 2.0E-125
sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2 93 574 7.0E-125
sp|Q2KJ46|PSMD3_BOVIN 26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1 93 574 1.0E-124
sp|P25161|PSMD3_DROME Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster GN=Rpn3 PE=2 SV=1 82 571 4.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42897|RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn3 PE=3 SV=2 68 582 2.0E-142
sp|P14685|PSMD3_MOUSE 26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=1 SV=3 72 574 2.0E-125
sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2 93 574 7.0E-125
sp|Q2KJ46|PSMD3_BOVIN 26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1 93 574 1.0E-124
sp|P25161|PSMD3_DROME Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster GN=Rpn3 PE=2 SV=1 82 571 4.0E-123
sp|Q1ZXD3|PSMD3_DICDI 26S proteasome non-ATPase regulatory subunit 3 OS=Dictyostelium discoideum GN=psmD3 PE=1 SV=1 95 582 1.0E-119
sp|O61470|PSMD3_ANOGA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae GN=Dox-A2 PE=3 SV=2 73 571 1.0E-118
sp|Q9U5Z8|PSMD3_ANOST Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles stephensi GN=DOXA2 PE=3 SV=1 73 575 5.0E-117
sp|Q9LNU4|PSD3A_ARATH 26S proteasome non-ATPase regulatory subunit 3 homolog A OS=Arabidopsis thaliana GN=RPN3A PE=1 SV=3 96 575 8.0E-94
sp|Q9LQR8|PSD3B_ARATH 26S proteasome non-ATPase regulatory subunit 3 homolog B OS=Arabidopsis thaliana GN=RPN3B PE=1 SV=2 73 575 2.0E-93
sp|P40016|RPN3_YEAST 26S proteasome regulatory subunit RPN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN3 PE=1 SV=5 106 582 5.0E-93
sp|P93768|PSMD3_TOBAC Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Nicotiana tabacum GN=21D7 PE=2 SV=1 164 548 8.0E-89
sp|Q06364|PSMD3_DAUCA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Daucus carota GN=21D7 PE=1 SV=2 73 548 9.0E-89
sp|Q04908|PSMD3_CAEEL 26S proteasome non-ATPase regulatory subunit 3 OS=Caenorhabditis elegans GN=rpn-3 PE=1 SV=1 80 575 2.0E-82
sp|Q8SRT7|RPN3_ENCCU 26S proteasome regulatory subunit RPN3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN3 PE=1 SV=1 313 543 3.0E-12
sp|A6H7B5|CSN3_BOVIN COP9 signalosome complex subunit 3 OS=Bos taurus GN=COPS3 PE=2 SV=1 335 540 3.0E-08
sp|O88543|CSN3_MOUSE COP9 signalosome complex subunit 3 OS=Mus musculus GN=Cops3 PE=1 SV=3 335 540 1.0E-07
sp|Q68FW9|CSN3_RAT COP9 signalosome complex subunit 3 OS=Rattus norvegicus GN=Cops3 PE=1 SV=1 335 540 2.0E-07
sp|Q5RFS2|CSN3_PONAB COP9 signalosome complex subunit 3 OS=Pongo abelii GN=COPS3 PE=2 SV=1 335 540 2.0E-07
sp|Q4R898|CSN3_MACFA COP9 signalosome complex subunit 3 OS=Macaca fascicularis GN=COPS3 PE=2 SV=1 335 540 2.0E-07
sp|Q9UNS2|CSN3_HUMAN COP9 signalosome complex subunit 3 OS=Homo sapiens GN=COPS3 PE=1 SV=3 335 540 2.0E-07
sp|Q54E53|CSN3_DICDI COP9 signalosome complex subunit 3 OS=Dictyostelium discoideum GN=csn3 PE=1 SV=1 333 514 2.0E-06
sp|Q5ZJF1|CSN3_CHICK COP9 signalosome complex subunit 3 OS=Gallus gallus GN=COPS3 PE=2 SV=1 335 540 4.0E-06
sp|Q7ZTN8|CSN3_XENLA COP9 signalosome complex subunit 3 OS=Xenopus laevis GN=cops3 PE=2 SV=1 335 540 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042176 regulation of protein catabolic process Yes
GO:0030234 enzyme regulator activity Yes
GO:0000502 proteasome complex Yes
GO:0005575 cellular_component No
GO:1905368 peptidase complex No
GO:0009894 regulation of catabolic process No
GO:0019222 regulation of metabolic process No
GO:0050789 regulation of biological process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0140535 intracellular protein-containing complex No
GO:0065007 biological regulation No
GO:1905369 endopeptidase complex No
GO:0098772 molecular function regulator activity No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0051246 regulation of protein metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1762
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7216 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1300
Ophiocordyceps camponoti-floridani Ophcf2|05185
Ophiocordyceps camponoti-rufipedis Ophun1|2468
Ophiocordyceps kimflemingae Ophio5|3244
Ophiocordyceps subramaniannii Hirsu2|1669

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7216
MPGKTPKGNSNGKEPLENGTRSTRDVDKDKDKESKSKGSKTTAAMDIDEEMTVVVPPSKASKQPKQSRDADGDVS
MNDGDEANDGQAGIDPTTQTVTDIKSNFALLDRAVALFDARFSLRALRSISLIRKRLTPEILGQVIAATFPATGP
SANIAHGLLAAIGHDGVSLGRPTSTEMDIDGESKQNKNGKKDQKEIIAEIDVYLGILVQVYLYDSNKYQNGAEFS
KLLSERVQTLNRRTLDSLSAKVYFYYSLFCEHLDPLPPCLESPIVAIRPTLLAALRTAVLRKDIDTQASVIVLLL
RNYLVTSHIGQADLLVSHTQFPENAVNNQVARFLYYLGRIRAIQLRYTEAHEHLTAATRKAPSSGCAVGFSQTAT
KLLLVVELLMGDIPERATFRQPSLEDALHPYFLLVQAVRIGNLEDFETVIADHADIFRRDGTYTLILRLRQNVIK
TGIRMMSLSYSRISLRDICIRLHLGSEESAEYIVAKAIRDGVIEATLDREHGFMKSKEVGDVYATREPGEAFHDR
IRACLSLHDESVKAMRFPMNQHRLELKNAQEAREREREMAKEIQDGDLDEDDLNGDFEGM*
Coding >OphauG2|7216
ATGCCTGGCAAAACGCCCAAAGGCAACAGCAACGGCAAGGAGCCTCTTGAAAATGGCACAAGGAGCACCCGAGAC
GTGGACAAGGATAAGGACAAGGAGTCAAAGTCAAAGGGCAGCAAGACGACAGCAGCAATGGACATTGACGAGGAA
ATGACTGTCGTTGTGCCACCGTCAAAGGCGTCGAAGCAGCCTAAGCAGTCAAGAGATGCTGACGGCGACGTTAGC
ATGAATGATGGCGACGAGGCCAATGACGGGCAGGCCGGCATTGACCCGACGACGCAAACTGTTACAGATATCAAA
AGCAACTTTGCCTTGCTTGACCGCGCCGTTGCCCTCTTCGATGCTAGGTTTTCGTTGCGAGCTCTGCGATCCATC
TCTCTGATCCGCAAGCGCCTAACGCCGGAAATCTTGGGCCAAGTGATTGCAGCAACCTTTCCCGCTACTGGCCCA
TCAGCCAACATAGCACATGGTCTCTTGGCAGCCATCGGACACGATGGCGTATCTCTGGGCCGCCCGACAAGCACC
GAAATGGACATTGATGGCGAGAGCAAGCAAAACAAGAATGGAAAGAAGGACCAAAAGGAAATCATAGCCGAAATT
GACGTCTATCTTGGCATTTTGGTGCAGGTATACCTGTACGACAGCAACAAGTATCAAAACGGCGCCGAATTCTCC
AAGCTCTTGTCAGAGCGCGTGCAGACGCTGAATCGTCGCACTCTGGATTCTCTTTCAGCAAAGGTGTACTTTTAC
TACTCGCTCTTTTGCGAGCACCTGGATCCGTTGCCACCGTGCCTCGAGTCGCCCATTGTCGCTATTCGTCCGACT
CTGCTGGCGGCCCTCCGAACGGCTGTGCTGCGCAAAGACATTGATACGCAAGCCTCGGTCATTGTTCTTTTACTG
CGCAACTATCTTGTCACGTCTCACATTGGTCAGGCCGACTTGCTTGTGTCTCACACGCAGTTTCCTGAAAACGCG
GTCAACAACCAGGTGGCACGGTTTCTCTACTACCTGGGTAGAATTCGAGCGATTCAGCTGCGCTACACCGAGGCC
CATGAGCATCTCACGGCGGCCACGCGTAAGGCTCCTTCGAGCGGGTGTGCGGTGGGCTTTTCACAGACTGCTACC
AAGCTTCTGCTCGTTGTGGAGCTTTTGATGGGCGATATCCCTGAGCGGGCGACATTTCGGCAGCCGTCGTTGGAG
GATGCTTTACATCCCTACTTCTTGCTGGTGCAGGCTGTACGGATTGGCAATCTGGAAGATTTTGAGACGGTCATT
GCCGACCACGCTGATATTTTCAGGCGAGACGGCACGTACACGCTGATTCTTCGCCTGCGGCAGAATGTCATCAAG
ACGGGCATCCGTATGATGTCGCTGTCGTATTCGCGTATTTCTCTTCGTGACATCTGCATCCGCCTTCACCTGGGA
AGTGAGGAATCTGCCGAGTACATAGTGGCCAAGGCGATACGGGATGGGGTGATTGAAGCCACGTTGGACCGAGAA
CACGGATTCATGAAGAGCAAGGAGGTTGGGGATGTTTATGCGACGAGAGAACCGGGGGAGGCATTTCACGATCGA
ATTCGAGCGTGTTTGTCACTGCACGACGAGAGCGTCAAGGCTATGCGATTTCCCATGAACCAACACCGCCTGGAA
CTTAAGAATGCGCAGGAAGCCAGGGAGCGAGAGAGGGAGATGGCAAAGGAGATCCAGGACGGCGACCTTGACGAA
GATGACTTGAATGGCGACTTTGAGGGCATGTAA
Transcript >OphauG2|7216
ATGCCTGGCAAAACGCCCAAAGGCAACAGCAACGGCAAGGAGCCTCTTGAAAATGGCACAAGGAGCACCCGAGAC
GTGGACAAGGATAAGGACAAGGAGTCAAAGTCAAAGGGCAGCAAGACGACAGCAGCAATGGACATTGACGAGGAA
ATGACTGTCGTTGTGCCACCGTCAAAGGCGTCGAAGCAGCCTAAGCAGTCAAGAGATGCTGACGGCGACGTTAGC
ATGAATGATGGCGACGAGGCCAATGACGGGCAGGCCGGCATTGACCCGACGACGCAAACTGTTACAGATATCAAA
AGCAACTTTGCCTTGCTTGACCGCGCCGTTGCCCTCTTCGATGCTAGGTTTTCGTTGCGAGCTCTGCGATCCATC
TCTCTGATCCGCAAGCGCCTAACGCCGGAAATCTTGGGCCAAGTGATTGCAGCAACCTTTCCCGCTACTGGCCCA
TCAGCCAACATAGCACATGGTCTCTTGGCAGCCATCGGACACGATGGCGTATCTCTGGGCCGCCCGACAAGCACC
GAAATGGACATTGATGGCGAGAGCAAGCAAAACAAGAATGGAAAGAAGGACCAAAAGGAAATCATAGCCGAAATT
GACGTCTATCTTGGCATTTTGGTGCAGGTATACCTGTACGACAGCAACAAGTATCAAAACGGCGCCGAATTCTCC
AAGCTCTTGTCAGAGCGCGTGCAGACGCTGAATCGTCGCACTCTGGATTCTCTTTCAGCAAAGGTGTACTTTTAC
TACTCGCTCTTTTGCGAGCACCTGGATCCGTTGCCACCGTGCCTCGAGTCGCCCATTGTCGCTATTCGTCCGACT
CTGCTGGCGGCCCTCCGAACGGCTGTGCTGCGCAAAGACATTGATACGCAAGCCTCGGTCATTGTTCTTTTACTG
CGCAACTATCTTGTCACGTCTCACATTGGTCAGGCCGACTTGCTTGTGTCTCACACGCAGTTTCCTGAAAACGCG
GTCAACAACCAGGTGGCACGGTTTCTCTACTACCTGGGTAGAATTCGAGCGATTCAGCTGCGCTACACCGAGGCC
CATGAGCATCTCACGGCGGCCACGCGTAAGGCTCCTTCGAGCGGGTGTGCGGTGGGCTTTTCACAGACTGCTACC
AAGCTTCTGCTCGTTGTGGAGCTTTTGATGGGCGATATCCCTGAGCGGGCGACATTTCGGCAGCCGTCGTTGGAG
GATGCTTTACATCCCTACTTCTTGCTGGTGCAGGCTGTACGGATTGGCAATCTGGAAGATTTTGAGACGGTCATT
GCCGACCACGCTGATATTTTCAGGCGAGACGGCACGTACACGCTGATTCTTCGCCTGCGGCAGAATGTCATCAAG
ACGGGCATCCGTATGATGTCGCTGTCGTATTCGCGTATTTCTCTTCGTGACATCTGCATCCGCCTTCACCTGGGA
AGTGAGGAATCTGCCGAGTACATAGTGGCCAAGGCGATACGGGATGGGGTGATTGAAGCCACGTTGGACCGAGAA
CACGGATTCATGAAGAGCAAGGAGGTTGGGGATGTTTATGCGACGAGAGAACCGGGGGAGGCATTTCACGATCGA
ATTCGAGCGTGTTTGTCACTGCACGACGAGAGCGTCAAGGCTATGCGATTTCCCATGAACCAACACCGCCTGGAA
CTTAAGAATGCGCAGGAAGCCAGGGAGCGAGAGAGGGAGATGGCAAAGGAGATCCAGGACGGCGACCTTGACGAA
GATGACTTGAATGGCGACTTTGAGGGCATGTAA
Gene >OphauG2|7216
ATGCCTGGCAAAACGCCCAAAGGCAACAGCAACGGCAAGGAGCCTCTTGAAAATGGCACAAGGAGCACCCGAGAC
GTGGACAAGGATAAGGACAAGGAGTCAAAGTCAAAGGGCAGCAAGACGACAGCAGCAATGGACATTGACGAGGAA
ATGACTGTCGTTGTGCCACCGTCAAAGGCGTCGAAGCAGCCTAAGCAGTCAAGAGATGCTGACGGCGACGTTAGC
ATGAATGATGGCGACGAGGCCAATGACGGGCAGGCCGGCATTGACCCGACGACGCAAACTGTTACAGGTGAGCAT
TCTGGAGCCTGATGATTGTGAATGGAGGCTTATTTCATCGTTTTTACTAGATATCAAAAGCAACTTTGCCTTGCT
TGACCGCGCCGTTGCCCTCTTCGATGCTAGGTTTTCGTTGCGAGCTCTGCGATCCATCTCTCTGATCCGCAAGCG
CCTAACGCCGGAAATCTTGGGCCAAGTGATTGCAGCAACCTTTCCCGCTACTGGCCCATCAGCCAACATAGCACA
TGGTCTCTTGGCAGCCATCGGACACGATGGCGTATCTCTGGGCCGCCCGACAAGCACCGAAATGGACATTGATGG
CGAGAGCAAGCAAAACAAGAATGGAAAGAAGGACCAAAAGGAAATCATAGCCGAAATTGACGTCTATCTTGGCAT
TTTGGTGCAGGTATACCTGTACGACAGCAACAAGTATCAAAACGGCGCCGAATTCTCCAAGCTCTTGTCAGAGCG
CGTGCAGACGCTGAATCGTCGCACTCTGGATTCTCTTTCAGCAAAGGTGTACTTTTACTACTCGCTCTTTTGCGA
GCACCTGGATCCGTTGCCACCGTGCCTCGAGTCGCCCATTGTCGCTATTCGTCCGACTCTGCTGGCGGCCCTCCG
AACGGCTGTGCTGCGCAAAGACATTGATACGCAAGCCTCGGTCATTGTTCTTTTACTGCGCAACTATCTTGTCAC
GTCTCACATTGGTCAGGCCGACTTGCTTGTGTCTCACACGCAGTTTCCTGAAAACGCGGTCAACAACCAGGTGGC
ACGGTTTCTCTACTACCTGGGTAGAATTCGAGCGATTCAGCTGCGCTACACCGAGGCCCATGAGCATCTCACGGC
GGCCACGCGTAAGGCTCCTTCGAGCGGGTGTGCGGTGGGCTTTTCACAGACTGCTACCAAGCTTCTGCTCGTTGT
GGAGCTTTTGATGGGCGATATCCCTGAGCGGGCGACATTTCGGCAGCCGTCGTTGGAGGATGCTTTACATCCCTA
CTTCTTGCTGGTGCAGGCTGTACGGATTGGCAATCTGGAAGATTTTGAGACGGTCATTGCCGACCACGCTGATAT
TTTCAGGCGAGACGGCACGTACACGCTGATTCTTCGCCTGCGGCAGAATGTCATCAAGACGGGCATCCGTATGAT
GTCGCTGTCGTATTCGCGTATTTCTCTTCGTGACATCTGCATCCGCCTTCACCTGGGAAGTGAGGAATCTGCCGA
GTACATAGTGGCCAAGGCGATACGGGATGGGGTGATTGAAGCCACGTTGGACCGAGAACACGGATTCATGAAGAG
CAAGGAGGTTGGGGATGTTTATGCGACGAGAGAACCGGGGGAGGCATTTCACGATCGAATTCGAGCGTGTTTGTC
ACTGCACGACGAGAGCGTCAAGGTGAGTTGGTTTCATGAGGAGTGCATGTGGGCGTTGGGCTGATGAGTTGGATG
ATGCTACAGGCTATGCGATTTCCCATGAACCAACACCGCCTGGAACTTAAGAATGCGCAGGAAGCCAGGGAGCGA
GAGAGGGAGATGGCAAAGGAGATCCAGGACGGCGACCTTGACGAAGATGACTTGAATGGCGACTTTGAGGGCATG
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail