Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7211
Gene name
LocationContig_814:1206..2273
Strand+
Gene length (bp)1067
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08450 SGL SMP-30/Gluconolactonase/LRE-like region 1.5E-25 94 315

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01578|GNL_ZYMMO Gluconolactonase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gnl PE=1 SV=2 24 325 7.0E-20

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7211 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3857
Ophiocordyceps camponoti-floridani Ophcf2|00633
Ophiocordyceps camponoti-rufipedis Ophun1|2245
Ophiocordyceps kimflemingae Ophio5|4215
Ophiocordyceps kimflemingae Ophio5|7650
Ophiocordyceps subramaniannii Hirsu2|6563

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7211
MAAQPHPSFLTIQPAVSEIFGTLPNLTVLHEMEIPFAHEAGVYLPDEEALFVTSNRFMDPQKNEETIIITRVLVP
ADGSAVKVETVNTENVPMANGGIRYTSNGYDGILFCAQGNMQVNGGISYMSTKVPYESQLLVNSFNGRPFNSPND
VVTHADGSIWFTDPIYGFEQGIRPKPRLPNQVYRYDPSNKSTRAVADGFGRPNGLAFSPDMKTLYVSDSDWIHGD
GTTDDTRVSHIYAFDVAKHSGGYFLENRRLFAMADNGIPDGVKCDVFGNVYSGCGDGINIWSPQGILIGKILVEG
GAANFCFGFNGQMFILAEKKLYSARLSPSVRGAFLDL*
Coding >OphauG2|7211
ATGGCTGCCCAACCTCATCCAAGTTTTCTTACAATTCAACCTGCCGTCTCTGAGATTTTTGGCACACTGCCAAAC
CTCACTGTTCTTCACGAGATGGAAATTCCATTTGCTCACGAAGCTGGCGTTTATCTCCCCGATGAAGAAGCCCTC
TTTGTCACTAGCAATCGCTTCATGGACCCCCAAAAAAACGAGGAGACAATAATAATAACTCGCGTGCTGGTTCCC
GCTGATGGAAGCGCCGTCAAAGTCGAGACTGTCAACACAGAAAACGTGCCCATGGCCAATGGCGGAATCCGCTAC
ACATCAAATGGCTACGATGGCATTCTCTTTTGCGCTCAGGGCAATATGCAAGTCAATGGCGGCATCTCCTACATG
AGCACCAAGGTTCCTTATGAGTCTCAACTGCTGGTAAATTCTTTCAACGGCCGGCCCTTCAACTCTCCAAACGAC
GTCGTCACCCATGCCGACGGCTCCATCTGGTTCACGGATCCCATCTACGGCTTTGAGCAAGGCATTAGGCCTAAG
CCTCGCTTGCCCAACCAAGTCTACAGATATGATCCCTCAAATAAATCGACCCGTGCAGTCGCCGATGGCTTTGGA
CGCCCCAATGGACTCGCCTTTAGCCCAGACATGAAGACTCTCTATGTGTCTGATTCAGATTGGATCCACGGCGAT
GGAACCACTGACGATACTCGCGTCTCTCACATATATGCCTTTGATGTTGCCAAGCATTCCGGAGGCTATTTTCTC
GAAAATCGCAGACTCTTTGCCATGGCTGACAATGGAATCCCTGACGGCGTCAAATGTGATGTCTTTGGCAATGTA
TACAGTGGCTGCGGAGATGGCATCAATATCTGGTCTCCCCAAGGCATCTTGATCGGCAAGATTCTAGTTGAAGGC
GGAGCCGCAAACTTTTGCTTTGGTTTTAACGGTCAAATGTTCATCTTGGCCGAGAAAAAGCTCTATTCCGCGCGG
CTTTCTCCTAGCGTCAGAGGTGCTTTCCTGGATCTTTAG
Transcript >OphauG2|7211
ATGGCTGCCCAACCTCATCCAAGTTTTCTTACAATTCAACCTGCCGTCTCTGAGATTTTTGGCACACTGCCAAAC
CTCACTGTTCTTCACGAGATGGAAATTCCATTTGCTCACGAAGCTGGCGTTTATCTCCCCGATGAAGAAGCCCTC
TTTGTCACTAGCAATCGCTTCATGGACCCCCAAAAAAACGAGGAGACAATAATAATAACTCGCGTGCTGGTTCCC
GCTGATGGAAGCGCCGTCAAAGTCGAGACTGTCAACACAGAAAACGTGCCCATGGCCAATGGCGGAATCCGCTAC
ACATCAAATGGCTACGATGGCATTCTCTTTTGCGCTCAGGGCAATATGCAAGTCAATGGCGGCATCTCCTACATG
AGCACCAAGGTTCCTTATGAGTCTCAACTGCTGGTAAATTCTTTCAACGGCCGGCCCTTCAACTCTCCAAACGAC
GTCGTCACCCATGCCGACGGCTCCATCTGGTTCACGGATCCCATCTACGGCTTTGAGCAAGGCATTAGGCCTAAG
CCTCGCTTGCCCAACCAAGTCTACAGATATGATCCCTCAAATAAATCGACCCGTGCAGTCGCCGATGGCTTTGGA
CGCCCCAATGGACTCGCCTTTAGCCCAGACATGAAGACTCTCTATGTGTCTGATTCAGATTGGATCCACGGCGAT
GGAACCACTGACGATACTCGCGTCTCTCACATATATGCCTTTGATGTTGCCAAGCATTCCGGAGGCTATTTTCTC
GAAAATCGCAGACTCTTTGCCATGGCTGACAATGGAATCCCTGACGGCGTCAAATGTGATGTCTTTGGCAATGTA
TACAGTGGCTGCGGAGATGGCATCAATATCTGGTCTCCCCAAGGCATCTTGATCGGCAAGATTCTAGTTGAAGGC
GGAGCCGCAAACTTTTGCTTTGGTTTTAACGGTCAAATGTTCATCTTGGCCGAGAAAAAGCTCTATTCCGCGCGG
CTTTCTCCTAGCGTCAGAGGTGCTTTCCTGGATCTTTAG
Gene >OphauG2|7211
ATGGCTGCCCAACCTCATCCAAGTTTTCTTACAATTCAACCTGCCGTCTCTGAGATTTTTGGCACACTGCCAAAC
CTCACTGTTCTTCACGAGATGGAAATTCCATTTGCTCACGAAGCTGGCGTTTATCTCCCCGATGAAGAAGCCCTC
TTTGTCACTAGCAATCGCTTCATGGACCCCCAAAAAAACGAGGAGACAATAATAATAACTCGCGTGCTGGTTCCC
GCTGATGGAAGCGCCGTCAAAGTCGAGACTGTCAACACAGAAAACGTGCCCATGGCCAATGGCGGAATCCGCTAC
ACATCAAATGGCTACGATGGCATTCTCTTTTGCGCTCAGGGCAATATGCAAGTCAATGGCGGCATCTCCTACATG
AGCACCAAGGTTCCTTATGAGTCTCAACTGCTGGTAAATTCTTTCAACGGCCGGCCCTTCAACTCTCCAAACGAC
GTCGTCACCCATGCCGACGGCTCCATCTGGTTCACGGATCCCATCTACGGCTTTGAGCAAGGCATTAGGCCTAAG
CCTCGCTTGCCCAACCAAGTCTACAGATATGATCCCTCAAATAAATCGACCCGTGCAGTCGCCGATGGCTTTGGA
CGCCCCAATGGACTCGCCTTTAGCCCAGACATGAAGACTCTCTATGTGTCTGATTCAGATTGGATCCACGGCGAT
GGAACCACTGACGATACTCGCGTCTCTCACATGTAGGCTCTTTGCTTTGAAATTCATGCTTCACAGCTGCTGATT
CTTGATCCAGATATGCCTTTGATGTTGCCAAGCATTCCGGAGGCTATTTTCTCGAAAATCGCAGACTCTTTGCCA
TGGCTGACAATGGAATCCCTGACGGCGTCAAATGTGATGTCTTTGGCAATGTATACAGTGGCTGCGGAGATGGCA
TCAATATCTGGTCTCCCCAAGGCATCTTGATCGGCAAGATTCTAGTTGAAGGCGGAGCCGCAAACTTTTGCTTTG
GTTTTAACGGTCAAATGTTCATCTTGGCCGAGAAAAAGCTCTATTCCGCGCGGCTTTCTCCTAGCGTCAGAGGTG
CTTTCCTGGATCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail