Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7206
Gene name
LocationContig_812:3767..6629
Strand-
Gene length (bp)2862
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 2.0E-49 436 790

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47950|CYT4_NEUCR Mitochondrial protein cyt-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-4 PE=3 SV=1 59 928 1.0E-137
sp|Q1MTN7|RPM1_SCHPO Exoribonuclease II, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpm1 PE=2 SV=2 231 791 2.0E-29
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 663 864 3.0E-07

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0004518 nuclease activity No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140098 catalytic activity, acting on RNA No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3762
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7206 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2261
Ophiocordyceps camponoti-floridani Ophcf2|04355
Ophiocordyceps camponoti-rufipedis Ophun1|3035
Ophiocordyceps kimflemingae Ophio5|6899
Ophiocordyceps subramaniannii Hirsu2|7339

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7206
MALIGNLANTTSRTQTTGSTALDQFGVVETTGTGPTSVTDAPATDAGVSHIGAAAHNPGDLVELRQSGSRVVHLA
IYLGFFGSRNHFYAINGRWIMSTSVSSYFTIPHFASLDELAPLLDAIPRNPSPDEYSRMLRDDEGPTREAGAHLL
HRMTSFREEADAIAKFNIGALESAHKHLYLKDESSYLSLGQIANALLPQGLKTAGHHSAHALYAVHLSILSKEIG
FSCLNLSTDSRRHDTLYEIFSQAHHDTIQRVVTLTRSYVERLVDNRQHDMHDDELRKFPMGHFILKARKVVTEAR
RFRSWNPAGISTCPYPANIANLTWDSESQDIIAFLEWWASYDLFAPGSHYNSYGATILRALGLYWDVDFNQATAW
TFLQEIGVIPPWDLPTRYRVRLPGVPVVNYGGLGRKTLDGMSESMRPDVAAGARRVVACENVFCIDDVSTTLVDD
AISLGRTDKANEFWIHIHVADPASGIMPDSGLCKYMELVPQNIYLPGHFQAMLPDSISDEHAKDYQSNKISDMYS
LRSHGPALTFSAKVNDAGDILDYKIEPTLLKNVISLEPDDVRSFCKEPASPLVDQKYNFSVGVKPQESTTKQRDM
MTVASLDESSKTDIETLYRLARTMEDKRLANGAWPWFAPTPTVNVLFHKSLENESTAAGQSLPPDPHIAVGMYPS
QSSTLVTNCMLLAGQVAARWCFDRGIPIPFRRNVKRNKTAAALDFAKAKLYPRIQKGLGAHRVDWQHLRALTGGV
EISSEPGSHFMIGLNMYTKATSPLRRFSDLLVHWQIHGALVYERKQQRRIDAQMDKLGDILPFTDQRLRDMLPML
GLRERMANRMSQGVLDWIMVALDRAWRIEHTVSGNLRFTVTTCSSSGLLGQLDMYGLNAALDHDGLNGCCLVRDV
RADDVFEVEIVKIVVPSRRILVKAVRFLGQDHDG*
Coding >OphauG2|7206
ATGGCCCTCATTGGAAACCTTGCCAACACCACGAGCAGGACGCAGACGACGGGCTCAACCGCCTTGGATCAGTTC
GGCGTCGTCGAGACGACGGGCACCGGTCCGACTTCAGTCACCGACGCCCCAGCCACTGATGCTGGCGTTTCCCAC
ATCGGCGCTGCTGCTCACAATCCCGGCGACCTGGTCGAGCTGCGTCAGTCTGGATCGCGTGTCGTCCACCTCGCC
ATATACCTCGGCTTCTTTGGCAGCCGCAACCACTTTTATGCTATCAACGGACGGTGGATCATGAGTACCAGCGTC
TCTTCCTACTTCACAATTCCCCATTTTGCCAGCCTTGACGAGCTTGCCCCCCTCCTTGACGCCATTCCACGCAAT
CCCTCTCCCGACGAATATTCACGAATGCTGCGAGACGACGAGGGCCCCACGCGAGAAGCCGGGGCCCATCTTCTC
CACAGGATGACGAGCTTCAGGGAGGAAGCAGATGCCATCGCCAAATTCAACATTGGCGCCCTTGAGTCTGCCCAC
AAGCATCTATATCTAAAAGACGAATCCAGCTATCTGAGCCTTGGTCAAATCGCAAACGCCCTCTTGCCTCAAGGT
CTCAAAACTGCAGGCCACCATTCTGCCCATGCGCTTTACGCCGTCCATCTTTCTATTCTCTCCAAGGAAATTGGC
TTTTCCTGCCTCAATCTTTCTACCGATAGCCGCCGTCACGACACCCTTTACGAAATATTTTCTCAGGCCCACCAT
GACACCATTCAACGAGTCGTCACCCTGACACGCAGCTATGTTGAGAGGCTGGTTGACAATCGGCAACATGACATG
CACGACGACGAGCTGCGCAAATTTCCCATGGGACACTTCATTCTCAAAGCGCGCAAAGTTGTTACCGAGGCTCGG
CGTTTTCGCTCATGGAATCCTGCTGGTATCTCGACTTGCCCATACCCCGCCAATATAGCAAACTTGACGTGGGAC
TCGGAAAGCCAAGACATCATCGCCTTTTTGGAGTGGTGGGCGAGTTACGACTTGTTCGCCCCCGGATCTCACTAC
AATTCTTACGGCGCCACCATACTCCGAGCCCTGGGCCTTTACTGGGACGTCGATTTCAACCAGGCTACGGCGTGG
ACCTTTTTGCAAGAAATTGGTGTCATTCCCCCTTGGGACCTGCCAACTCGATATCGCGTGCGGCTGCCGGGTGTC
CCAGTCGTCAACTACGGCGGGCTCGGTCGCAAAACTCTAGATGGCATGTCCGAATCCATGCGACCCGACGTAGCT
GCAGGGGCGAGAAGGGTAGTAGCTTGCGAAAACGTCTTCTGTATTGACGACGTTTCTACCACCCTTGTCGACGAT
GCCATCTCGCTCGGGCGTACGGACAAGGCCAATGAATTTTGGATTCATATCCACGTAGCTGATCCTGCCTCGGGA
ATCATGCCGGATTCAGGCCTGTGCAAGTACATGGAGCTCGTTCCGCAAAACATTTATCTTCCAGGGCACTTCCAG
GCTATGCTGCCAGACAGCATCTCCGACGAGCACGCCAAGGACTACCAGTCAAACAAGATCAGCGACATGTACTCA
CTTCGTAGCCACGGGCCAGCCTTGACCTTTAGTGCCAAGGTTAACGACGCCGGAGACATTCTCGACTATAAAATC
GAGCCCACTTTGCTGAAAAATGTCATTTCGCTGGAGCCTGACGACGTGCGAAGCTTTTGCAAGGAGCCAGCGTCG
CCACTAGTAGATCAAAAATACAACTTTTCGGTTGGCGTCAAGCCCCAGGAAAGCACGACAAAGCAACGCGACATG
ATGACTGTTGCAAGCTTGGATGAGTCGAGCAAAACTGACATTGAAACATTGTATCGTCTTGCCCGGACTATGGAA
GACAAAAGATTGGCCAATGGCGCCTGGCCCTGGTTTGCGCCAACGCCAACGGTCAATGTTCTATTCCACAAGAGT
CTAGAGAATGAATCCACTGCTGCTGGCCAGTCTCTGCCTCCCGATCCGCATATTGCAGTCGGCATGTACCCCAGT
CAAAGTTCGACTCTGGTTACCAACTGTATGCTTCTAGCAGGACAGGTGGCGGCTCGTTGGTGTTTTGATCGCGGA
ATCCCAATTCCATTTCGCCGCAATGTCAAGAGGAACAAGACGGCGGCGGCTCTGGACTTTGCCAAGGCCAAGTTG
TATCCTCGCATACAAAAAGGCCTTGGGGCCCATCGTGTTGATTGGCAGCATCTCAGGGCGCTGACTGGAGGAGTT
GAGATATCGTCAGAGCCTGGATCCCACTTTATGATTGGCTTGAACATGTACACCAAGGCAACATCGCCTCTGCGG
CGCTTTTCCGACTTGCTGGTTCACTGGCAAATACACGGGGCCCTGGTATATGAGCGAAAGCAGCAGCGGCGCATA
GACGCGCAAATGGACAAATTGGGCGACATTTTACCCTTTACAGACCAGAGGTTGCGGGATATGCTGCCCATGTTG
GGGTTACGCGAGAGGATGGCAAACAGGATGTCACAGGGAGTCTTGGACTGGATCATGGTTGCGCTGGATCGTGCT
TGGCGCATTGAACACACAGTGTCGGGAAATTTGCGATTTACCGTTACTACCTGTTCGTCGAGCGGTCTGTTGGGC
CAGCTCGACATGTATGGCCTCAATGCCGCCCTCGACCATGATGGGCTCAACGGCTGTTGCCTAGTCAGGGATGTG
CGCGCCGACGATGTCTTTGAAGTCGAAATCGTCAAAATCGTTGTCCCGTCGCGCCGCATCCTTGTCAAGGCTGTG
CGCTTCCTCGGTCAGGACCATGACGGCTAA
Transcript >OphauG2|7206
ATGGCCCTCATTGGAAACCTTGCCAACACCACGAGCAGGACGCAGACGACGGGCTCAACCGCCTTGGATCAGTTC
GGCGTCGTCGAGACGACGGGCACCGGTCCGACTTCAGTCACCGACGCCCCAGCCACTGATGCTGGCGTTTCCCAC
ATCGGCGCTGCTGCTCACAATCCCGGCGACCTGGTCGAGCTGCGTCAGTCTGGATCGCGTGTCGTCCACCTCGCC
ATATACCTCGGCTTCTTTGGCAGCCGCAACCACTTTTATGCTATCAACGGACGGTGGATCATGAGTACCAGCGTC
TCTTCCTACTTCACAATTCCCCATTTTGCCAGCCTTGACGAGCTTGCCCCCCTCCTTGACGCCATTCCACGCAAT
CCCTCTCCCGACGAATATTCACGAATGCTGCGAGACGACGAGGGCCCCACGCGAGAAGCCGGGGCCCATCTTCTC
CACAGGATGACGAGCTTCAGGGAGGAAGCAGATGCCATCGCCAAATTCAACATTGGCGCCCTTGAGTCTGCCCAC
AAGCATCTATATCTAAAAGACGAATCCAGCTATCTGAGCCTTGGTCAAATCGCAAACGCCCTCTTGCCTCAAGGT
CTCAAAACTGCAGGCCACCATTCTGCCCATGCGCTTTACGCCGTCCATCTTTCTATTCTCTCCAAGGAAATTGGC
TTTTCCTGCCTCAATCTTTCTACCGATAGCCGCCGTCACGACACCCTTTACGAAATATTTTCTCAGGCCCACCAT
GACACCATTCAACGAGTCGTCACCCTGACACGCAGCTATGTTGAGAGGCTGGTTGACAATCGGCAACATGACATG
CACGACGACGAGCTGCGCAAATTTCCCATGGGACACTTCATTCTCAAAGCGCGCAAAGTTGTTACCGAGGCTCGG
CGTTTTCGCTCATGGAATCCTGCTGGTATCTCGACTTGCCCATACCCCGCCAATATAGCAAACTTGACGTGGGAC
TCGGAAAGCCAAGACATCATCGCCTTTTTGGAGTGGTGGGCGAGTTACGACTTGTTCGCCCCCGGATCTCACTAC
AATTCTTACGGCGCCACCATACTCCGAGCCCTGGGCCTTTACTGGGACGTCGATTTCAACCAGGCTACGGCGTGG
ACCTTTTTGCAAGAAATTGGTGTCATTCCCCCTTGGGACCTGCCAACTCGATATCGCGTGCGGCTGCCGGGTGTC
CCAGTCGTCAACTACGGCGGGCTCGGTCGCAAAACTCTAGATGGCATGTCCGAATCCATGCGACCCGACGTAGCT
GCAGGGGCGAGAAGGGTAGTAGCTTGCGAAAACGTCTTCTGTATTGACGACGTTTCTACCACCCTTGTCGACGAT
GCCATCTCGCTCGGGCGTACGGACAAGGCCAATGAATTTTGGATTCATATCCACGTAGCTGATCCTGCCTCGGGA
ATCATGCCGGATTCAGGCCTGTGCAAGTACATGGAGCTCGTTCCGCAAAACATTTATCTTCCAGGGCACTTCCAG
GCTATGCTGCCAGACAGCATCTCCGACGAGCACGCCAAGGACTACCAGTCAAACAAGATCAGCGACATGTACTCA
CTTCGTAGCCACGGGCCAGCCTTGACCTTTAGTGCCAAGGTTAACGACGCCGGAGACATTCTCGACTATAAAATC
GAGCCCACTTTGCTGAAAAATGTCATTTCGCTGGAGCCTGACGACGTGCGAAGCTTTTGCAAGGAGCCAGCGTCG
CCACTAGTAGATCAAAAATACAACTTTTCGGTTGGCGTCAAGCCCCAGGAAAGCACGACAAAGCAACGCGACATG
ATGACTGTTGCAAGCTTGGATGAGTCGAGCAAAACTGACATTGAAACATTGTATCGTCTTGCCCGGACTATGGAA
GACAAAAGATTGGCCAATGGCGCCTGGCCCTGGTTTGCGCCAACGCCAACGGTCAATGTTCTATTCCACAAGAGT
CTAGAGAATGAATCCACTGCTGCTGGCCAGTCTCTGCCTCCCGATCCGCATATTGCAGTCGGCATGTACCCCAGT
CAAAGTTCGACTCTGGTTACCAACTGTATGCTTCTAGCAGGACAGGTGGCGGCTCGTTGGTGTTTTGATCGCGGA
ATCCCAATTCCATTTCGCCGCAATGTCAAGAGGAACAAGACGGCGGCGGCTCTGGACTTTGCCAAGGCCAAGTTG
TATCCTCGCATACAAAAAGGCCTTGGGGCCCATCGTGTTGATTGGCAGCATCTCAGGGCGCTGACTGGAGGAGTT
GAGATATCGTCAGAGCCTGGATCCCACTTTATGATTGGCTTGAACATGTACACCAAGGCAACATCGCCTCTGCGG
CGCTTTTCCGACTTGCTGGTTCACTGGCAAATACACGGGGCCCTGGTATATGAGCGAAAGCAGCAGCGGCGCATA
GACGCGCAAATGGACAAATTGGGCGACATTTTACCCTTTACAGACCAGAGGTTGCGGGATATGCTGCCCATGTTG
GGGTTACGCGAGAGGATGGCAAACAGGATGTCACAGGGAGTCTTGGACTGGATCATGGTTGCGCTGGATCGTGCT
TGGCGCATTGAACACACAGTGTCGGGAAATTTGCGATTTACCGTTACTACCTGTTCGTCGAGCGGTCTGTTGGGC
CAGCTCGACATGTATGGCCTCAATGCCGCCCTCGACCATGATGGGCTCAACGGCTGTTGCCTAGTCAGGGATGTG
CGCGCCGACGATGTCTTTGAAGTCGAAATCGTCAAAATCGTTGTCCCGTCGCGCCGCATCCTTGTCAAGGCTGTG
CGCTTCCTCGGTCAGGACCATGACGGCTAA
Gene >OphauG2|7206
ATGGCCCTCATTGGAAACCTTGCCAACACCACGAGCAGGACGCAGACGACGGGCTCAACCGCCTTGGATCAGTTC
GGCGTCGTCGAGACGACGGGCACCGGTCCGACTTCAGTCACCGACGCCCCAGCCACTGATGCTGGCGTTTCCCAC
ATCGGCGCTGCTGCTCACAATCCCGGCGACCTGGTCGAGCTGCGGTGCGTAGATTGACCATGTCCCCCAGTCTCC
CCTGCTAATCCAATTGTCCATTACAGTCAGTCTGGATCGCGTGTCGTCCACCTCGCCATATACCTCGGCTTCTTT
GGCAGCCGCAACCACTTTTATGCTATCAACGGACGGTGGATCATGAGTACCAGCGTCTCTTCCTACTTCACAATT
CCCCATTTTGCCAGCCTTGACGAGCTTGCCCCCCTCCTTGACGCCATTCCACGCAATCCCTCTCCCGACGAATAT
TCACGAATGCTGCGAGACGACGAGGGCCCCACGCGAGAAGCCGGGGCCCATCTTCTCCACAGGATGACGAGCTTC
AGGGAGGAAGCAGATGCCATCGCCAAATTCAACATTGGCGCCCTTGAGTCTGCCCACAAGCATCTATATCTAAAA
GACGAATCCAGCTATCTGAGCCTTGGTCAAATCGCAAACGCCCTCTTGCCTCAAGGTCTCAAAACTGCAGGCCAC
CATTCTGCCCATGCGCTTTACGCCGTCCATCTTTCTATTCTCTCCAAGGAAATTGGCTTTTCCTGCCTCAATCTT
TCTACCGATAGCCGCCGTCACGACACCCTTTACGAAATATTTTCTCAGGCCCACCATGACACCATTCAACGAGTC
GTCACCCTGACACGCAGCTATGTTGAGAGGCTGGTTGACAATCGGCAACATGACATGCACGACGACGAGCTGCGC
AAATTTCCCATGGGACACTTCATTCTCAAAGCGCGCAAAGTTGTTACCGAGGCTCGGCGTTTTCGCTCATGGAAT
CCTGCTGGTATCTCGACTTGCCCATACCCCGCCAATATAGCAAACTTGACGTGGGACTCGGAAAGCCAAGACATC
ATCGCCTTTTTGGAGTGGTGGGCGAGTTACGACTTGTTCGCCCCCGGATCTCACTACAATTCTTACGGCGCCACC
ATACTCCGAGCCCTGGGCCTTTACTGGGACGTCGATTTCAACCAGGCTACGGCGTGGACCTTTTTGCAAGAAATT
GGTGTCATTCCCCCTTGGGACCTGCCAACTCGATATCGCGTGCGGCTGCCGGGTGTCCCAGTCGTCAACTACGGC
GGGCTCGGTCGCAAAACTCTAGATGGCATGTCCGAATCCATGCGACCCGACGTAGCTGCAGGGGCGAGAAGGGTA
GTAGCTTGCGAAAACGTCTTCTGTATTGACGACGTTTCTACCACCCTTGTCGACGATGCCATCTCGCTCGGGCGT
ACGGACAAGGCCAATGAATTTTGGATTCATATCCACGTAGCTGATCCTGCCTCGGGAATCATGCCGGATTCAGGC
CTGTGCAAGTACATGGAGCTCGTTCCGCAAAACATTTATCTTCCAGGGCACTTCCAGGCTATGCTGCCAGACAGC
ATCTCCGACGAGCACGCCAAGGACTACCAGTCAAACAAGATCAGCGACATGTACTCACTTCGTAGCCACGGGCCA
GCCTTGACCTTTAGTGCCAAGGTTAACGACGCCGGAGACATTCTCGACTATAAAATCGAGCCCACTTTGCTGAAA
AATGTCATTTCGCTGGAGCCTGACGACGTGCGAAGCTTTTGCAAGGAGCCAGCGTCGCCACTAGTAGATCAAAAA
TACAACTTTTCGGTTGGCGTCAAGCCCCAGGAAAGCACGACAAAGCAACGCGACATGATGACTGTTGCAAGCTTG
GATGAGTCGAGCAAAACTGACATTGAAACATTGTATCGTCTTGCCCGGACTATGGAAGACAAAAGATTGGCCAAT
GGCGCCTGGCCCTGGTTTGCGCCAACGCCAACGGTCAATGTTCTATTCCACAAGAGTCTAGAGAATGAATCCACT
GCTGCTGGCCAGTCTCTGCCTCCCGATCCGCATATTGCAGTCGGCATGTACCCCAGTCAAAGTTCGACTCTGGTT
ACCAACTGTATGCTTCTAGCAGGACAGGTGGCGGCTCGTTGGTGTTTTGATCGCGGAATCCCAATTCCATTTCGC
CGCAATGTCAAGAGGAACAAGACGGCGGCGGCTCTGGACTTTGCCAAGGCCAAGTTGTATCCTCGCATACAAAAA
GGCCTTGGGGCCCATCGTGTTGATTGGCAGCATCTCAGGGCGCTGACTGGAGGAGTTGAGATATCGTCAGAGCCT
GGATCCCACTTTATGATTGGCTTGAACATGTACACCAAGGCAACATCGCCTCTGCGGCGCTTTTCCGACTTGCTG
GTTCACTGGCAAATACACGGGGCCCTGGTATATGAGCGAAAGCAGCAGCGGCGCATAGACGCGCAAATGGACAAA
TTGGGCGACATTTTACCCTTTACAGACCAGAGGTTGCGGGATATGCTGCCCATGTTGGGGTTACGCGAGAGGATG
GCAAACAGGATGTCACAGGGAGTCTTGGACTGGATCATGGTTGCGCTGGATCGTGCTTGGCGCATTGAACACACA
GTGTCGGGAAATTTGCGATTTACCGTTACTACCTGTTCGTCGAGCGGTCTGTTGGGCCAGCTCGACATGTATGGC
CTCAATGCCGCCCTCGACCATGATGGGCTCAACGGCTGTTGCCTAGTCAGGGATGTGCGCGCCGACGATGTCTTT
GAAGTCGAAATCGTCAAAATCGTTGTCCCGTCGCGCCGCATCCTTGTCAAGGCTGTGCGCTTCCTCGGTCAGGAC
CATGACGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail